GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2026-11-11 15:33:36, GGRNA : RefSeq release 233 (Jan, 2026)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Procambarus clarkii aggrecan core protein-like (LOC138355995), mRNA. (870 bp)
analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:138355995" CDS 1..870 /gene="LOC138355995" /codon_start=1 /product="aggrecan core protein-like" /protein_id="XP_069167641.1" /db_xref="GeneID:138355995" /translation="MCERYTTPGDICERYTTPGDISIYYAPVIFVRYILRPGDICERYTTPGDICERYTTPGDICERYTTPGDICERYTTPGDICERYTTARTQTPSSFKPRTQTPSSLRFRAETPSSLRLRAETPSSLRLRAVTPSSFLLRAPIPSSLRLRTETPSSLRLRTETPSSLWLRAESPSFPRLRAETLNFLRLRAETPSFLRLRTETLNFLRLRAETPSFLRLRAEILNFLRIRSETPRSLRLRAETLNFLRLRAETPSSLRLKAETPSFLRLRAETLNFFRLRGRDSQLSQAQS" ORIGIN //...
AA_position 10
XM_069311540.1 - Procambarus clarkii (red swamp crayfish) - NCBI
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X10, mRNA. (1753 bp)
of the annotated genomic feature by RNAseq alignments, including 86 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 374..1753 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_046774599.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918643.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X10, mRNA. (1753 bp)
of the annotated genomic feature by RNAseq alignments, including 86 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 374..1753 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_046797761.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941805.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X2, mRNA. (10772 bp)
="DICER1" /gene_synonym="dicer" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 11 ESTs, 879 long SRA reads, 20 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 399..6164 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer...
Synonym: dicer
XM_046918635.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X2, mRNA. (10773 bp)
="DICER1" /gene_synonym="dicer" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 11 ESTs, 876 long SRA reads, 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 399..6164 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer...
Synonym: dicer
XM_046941796.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X5, mRNA. (10636 bp)
of the annotated genomic feature by RNAseq alignments, including 26 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 263..6028 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046774594.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918638.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X3, mRNA. (10639 bp)
of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 266..6031 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046774592.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918636.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X5, mRNA. (10637 bp)
of the annotated genomic feature by RNAseq alignments, including 26 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 263..6028 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797755.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941799.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X3, mRNA. (10640 bp)
of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 266..6031 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797753.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941797.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X7, mRNA. (10746 bp)
of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 373..6138 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046774596.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918640.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X4, mRNA. (10744 bp)
of the annotated genomic feature by RNAseq alignments, including 75 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 371..6136 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046774593.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918637.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X1, mRNA. (10749 bp)
of the annotated genomic feature by RNAseq alignments, including 31 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 376..6141 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046774590.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918634.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X7, mRNA. (10747 bp)
of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 373..6138 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797757.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941801.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X4, mRNA. (10745 bp)
of the annotated genomic feature by RNAseq alignments, including 75 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 371..6136 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797754.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941798.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X1, mRNA. (10750 bp)
of the annotated genomic feature by RNAseq alignments, including 31 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 376..6141 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797751.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941795.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X8, mRNA. (10798 bp)
of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 425..6190 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046774597.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918641.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X6, mRNA. (10795 bp)
of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 422..6187 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046774595.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918639.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X8, mRNA. (10799 bp)
of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 425..6190 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797758.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941802.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X6, mRNA. (10796 bp)
of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 422..6187 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797756.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941800.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X11, mRNA. (15494 bp)
of the annotated genomic feature by RNAseq alignments, including 31 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 5120..10885 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797760.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941804.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X9, mRNA. (10852 bp)
of the annotated genomic feature by RNAseq alignments, including 35 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 479..6244 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046774598.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046918642.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1), transcript variant X9, mRNA. (10853 bp)
of the annotated genomic feature by RNAseq alignments, including 35 samples with support for all annotated introns" /db_xref="CGNC:8359" /db_xref="GeneID:423437" misc_feature 1 /gene="DICER1" /gene_synonym="dicer" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 479..6244 /gene="DICER1" /gene_synonym="dicer" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_046797759.1" /db_xref="GeneID:423437" /db_xref="CGNC:8359" /translation="...
Synonym: dicer
XM_046941803.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Astyanax mexicanus dicer 1, ribonuclease type III (dicer1), transcript variant X3, misc_RNA. (15751 bp)
LOCUS XR_007423994 15751 bp RNA linear VRT 21-JUL-2022 DEFINITION PREDICTED: Astyanax mexicanus dicer 1, ribonuclease type III (dicer1), transcript variant X3, misc_RNA. ACCESSION XR_007423994 VERSION XR_007423994.1 DBLINK BioProject: PRJNA853366 KEYWORDS RefSeq. SOURCE Astyanax mexicanus (Mexican tetra) ORGANISM Astyanax mexicanus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Characiformes; Characoidei; Acestrorhamphidae; Acestrorhamphinae; Astyanax. COMMENT MODEL REFSEQ: This record is predicted by automated...
XR_007423994.1 - Astyanax mexicanus (Mexican tetra) - NCBI
PREDICTED: Astyanax mexicanus dicer 1, ribonuclease type III (dicer1), transcript variant X2, misc_RNA. (15942 bp)
LOCUS XR_007423993 15942 bp RNA linear VRT 21-JUL-2022 DEFINITION PREDICTED: Astyanax mexicanus dicer 1, ribonuclease type III (dicer1), transcript variant X2, misc_RNA. ACCESSION XR_007423993 VERSION XR_007423993.1 DBLINK BioProject: PRJNA853366 KEYWORDS RefSeq. SOURCE Astyanax mexicanus (Mexican tetra) ORGANISM Astyanax mexicanus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Characiformes; Characoidei; Acestrorhamphidae; Acestrorhamphinae; Astyanax. COMMENT MODEL REFSEQ: This record is predicted by automated...
XR_007423993.1 - Astyanax mexicanus (Mexican tetra) - NCBI
PREDICTED: Brienomyrus brachyistius dicer 1, ribonuclease type III (dicer1), transcript variant X4, mRNA. (2494 bp)
brachyistius" /mol_type="mRNA" /isolate="T26" /db_xref="taxon:42636" /chromosome="14" /sex="male" /tissue_type="skeletal muscle" gene 1..2494 /gene="dicer1" /note="dicer 1, ribonuclease type III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:125707158" CDS 302..2479 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X4" /protein_id="XP_048830063.1" /db_xref="GeneID:125707158" /translation="...
XM_048974106.1 - Brienomyrus brachyistius - NCBI
PREDICTED: Podarcis raffonei dicer 1, ribonuclease III (DICER1), transcript variant X2, misc_RNA. (3355 bp)
LOCUS XR_008328802 3355 bp RNA linear VRT 26-FEB-2023 DEFINITION PREDICTED: Podarcis raffonei dicer 1, ribonuclease III (DICER1), transcript variant X2, misc_RNA. ACCESSION XR_008328802 VERSION XR_008328802.1 DBLINK BioProject: PRJNA928705 KEYWORDS RefSeq. SOURCE Podarcis raffonei (Aeolian wall lizard) ORGANISM Podarcis raffonei Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata; Laterata; Lacertibaenia; Lacertidae; Podarcis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record...
XR_008328802.1 - Podarcis raffonei (Aeolian wall lizard) - NCBI
PREDICTED: Leopardus geoffroyi dicer 1, ribonuclease III (DICER1), transcript variant X6, misc_RNA. (2410 bp)
LOCUS XR_006705287 2410 bp RNA linear MAM 17-DEC-2021 DEFINITION PREDICTED: Leopardus geoffroyi dicer 1, ribonuclease III (DICER1), transcript variant X6, misc_RNA. ACCESSION XR_006705287 VERSION XR_006705287.1 DBLINK BioProject: PRJNA786922 KEYWORDS RefSeq. SOURCE Leopardus geoffroyi (Geoffroy's cat) ORGANISM Leopardus geoffroyi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae; Felinae; Leopardus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a...
XR_006705287.1 - Leopardus geoffroyi (Geoffroy's cat) - NCBI
PREDICTED: Bubalus bubalis dicer 1, ribonuclease III (DICER1), transcript variant X5, mRNA. (2444 bp)
misc_feature 467..1060 /gene="DICER1" /note="DEXH-box helicase domain of endoribonuclease Dicer; Region: DEXHc_dicer; cd18034" /db_xref="CDD:350792" misc_feature order(467..478,485..487,536..559,680..682,869..871, 962..964) /gene="DICER1" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:350792" misc_feature order(644..649,716..721,794..796,800..805,812..814, 887..895) /gene="DICER1" /note="nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:350792" misc_feature 1154..1438 /gene="DICER1" /note="Partner-binding domain of the endoribonuclease Dicer;...
XM_044932834.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Silurus meridionalis dicer 1, ribonuclease type III (dicer1), transcript variant X2, misc_RNA. (6247 bp)
LOCUS XR_006926681 6247 bp RNA linear VRT 18-FEB-2022 DEFINITION PREDICTED: Silurus meridionalis dicer 1, ribonuclease type III (dicer1), transcript variant X2, misc_RNA. ACCESSION XR_006926681 VERSION XR_006926681.1 DBLINK BioProject: PRJNA807317 KEYWORDS RefSeq. SOURCE Silurus meridionalis (Silurus soldatovi meridionalis) ORGANISM Silurus meridionalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Siluridae; Silurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This...
XR_006926681.1 - Silurus meridionalis (Silurus soldatovi meridionalis) - NCBI
PREDICTED: Epinephelus fuscoguttatus dicer 1, ribonuclease type III (dicer1), transcript variant X3, mRNA. (3008 bp)
mol_type="mRNA" /db_xref="taxon:293821" /geo_loc_name="China" /collection_date="2018-12" /linkage_group="LG14" /note="scaffold1" gene 1..3008 /gene="dicer1" /note="dicer 1, ribonuclease type III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:125900927" CDS 381..3008 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_049452177.1" /db_xref="GeneID:125900927" /translation="...
XM_049596220.1 - Epinephelus fuscoguttatus (brown-marbled grouper) - NCBI
PREDICTED: Muntiacus reevesi dicer 1, ribonuclease III (DICER1), transcript variant X4, misc_RNA. (11005 bp)
LOCUS XR_010659202 11005 bp RNA linear MAM 22-JUN-2024 DEFINITION PREDICTED: Muntiacus reevesi dicer 1, ribonuclease III (DICER1), transcript variant X4, misc_RNA. ACCESSION XR_010659202 VERSION XR_010659202.1 DBLINK BioProject: PRJNA1126686 KEYWORDS RefSeq. SOURCE Muntiacus reevesi (Reeves' muntjac) ORGANISM Muntiacus reevesi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Cervidae; Muntiacinae; Muntiacus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is...
XR_010659202.1 - Muntiacus reevesi (Reeves' muntjac) - NCBI
PREDICTED: Hippoglossus stenolepis dicer 1, ribonuclease type III (dicer1), transcript variant X5, misc_RNA. (7660 bp)
LOCUS XR_007033011 7660 bp RNA linear VRT 04-APR-2022 DEFINITION PREDICTED: Hippoglossus stenolepis dicer 1, ribonuclease type III (dicer1), transcript variant X5, misc_RNA. ACCESSION XR_007033011 VERSION XR_007033011.1 DBLINK BioProject: PRJNA642014 KEYWORDS RefSeq. SOURCE Hippoglossus stenolepis (Pacific halibut) ORGANISM Hippoglossus stenolepis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Pleuronectiformes; Pleuronectoidei; Pleuronectidae; Hippoglossus. COMMENT MODEL REFSEQ: This record...
XR_007033011.1 - Hippoglossus stenolepis (Pacific halibut) - NCBI
PREDICTED: Hippoglossus stenolepis dicer 1, ribonuclease type III (dicer1), transcript variant X3, misc_RNA. (7486 bp)
LOCUS XR_007033010 7486 bp RNA linear VRT 04-APR-2022 DEFINITION PREDICTED: Hippoglossus stenolepis dicer 1, ribonuclease type III (dicer1), transcript variant X3, misc_RNA. ACCESSION XR_007033010 VERSION XR_007033010.1 DBLINK BioProject: PRJNA642014 KEYWORDS RefSeq. SOURCE Hippoglossus stenolepis (Pacific halibut) ORGANISM Hippoglossus stenolepis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Pleuronectiformes; Pleuronectoidei; Pleuronectidae; Hippoglossus. COMMENT MODEL REFSEQ: This record...
XR_007033010.1 - Hippoglossus stenolepis (Pacific halibut) - NCBI
PREDICTED: Neomonachus schauinslandi dicer 1, ribonuclease III (DICER1), transcript variant X6, mRNA. (2538 bp)
misc_feature 295..888 /gene="DICER1" /note="DEXH-box helicase domain of endoribonuclease Dicer; Region: DEXHc_dicer; cd18034" /db_xref="CDD:350792" misc_feature order(295..306,313..315,364..387,508..510,697..699, 790..792) /gene="DICER1" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:350792" misc_feature order(472..477,544..549,622..624,628..633,640..642, 715..723) /gene="DICER1" /note="nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:350792" misc_feature 988..1266 /gene="DICER1" /note="Partner-binding domain of the endoribonuclease Dicer; Region...
XM_044918342.1 - Neomonachus schauinslandi (Hawaiian monk seal) - NCBI
PREDICTED: Hippocampus zosterae dicer 1, ribonuclease type III (dicer1), transcript variant X3, mRNA. (1678 bp)
mol_type="mRNA" /strain="Florida" /db_xref="taxon:109293" /chromosome="14" /sex="male" /tissue_type="body" /dev_stage="adult" gene 1..1678 /gene="dicer1" /note="dicer 1, ribonuclease type III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:127614379" CDS 329..1678 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_051941608.1" /db_xref="GeneID:127614379" /translation="...
XM_052085648.1 - Hippocampus zosterae (dwarf seahorse) - NCBI
PREDICTED: Syngnathus scovelli dicer 1, ribonuclease type III (dicer1), transcript variant X6, misc_RNA. (3332 bp)
LOCUS XR_007485931 3332 bp RNA linear VRT 23-SEP-2024 DEFINITION PREDICTED: Syngnathus scovelli dicer 1, ribonuclease type III (dicer1), transcript variant X6, misc_RNA. ACCESSION XR_007485931 VERSION XR_007485931.1 DBLINK BioProject: PRJNA863313 KEYWORDS RefSeq. SOURCE Syngnathus scovelli (Gulf pipefish) ORGANISM Syngnathus scovelli Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Syngnathus. COMMENT MODEL REFSEQ: This record is predicted by...
XR_007485931.1 - Syngnathus scovelli (Gulf pipefish) - NCBI
PREDICTED: Antennarius striatus dicer 1, ribonuclease type III (dicer1), transcript variant X2, misc_RNA. (16697 bp)
LOCUS XR_011038519 16697 bp RNA linear VRT 14-SEP-2024 DEFINITION PREDICTED: Antennarius striatus dicer 1, ribonuclease type III (dicer1), transcript variant X2, misc_RNA. ACCESSION XR_011038519 VERSION XR_011038519.1 DBLINK BioProject: PRJNA1159349 KEYWORDS RefSeq. SOURCE Antennarius striatus (striated frogfish) ORGANISM Antennarius striatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Lophiiformes; Antennarioidei; Antennariidae; Antennarius. COMMENT MODEL REFSEQ: This record is predicted...
XR_011038519.1 - Antennarius striatus (striated frogfish) - NCBI
PREDICTED: Perognathus longimembris pacificus dicer 1, ribonuclease III (Dicer1), transcript variant X5, misc_RNA. (2285 bp)
LOCUS XR_007213257 2285 bp RNA linear ROD 19-MAY-2022 DEFINITION PREDICTED: Perognathus longimembris pacificus dicer 1, ribonuclease III (Dicer1), transcript variant X5, misc_RNA. ACCESSION XR_007213257 VERSION XR_007213257.1 DBLINK BioProject: PRJNA837248 KEYWORDS RefSeq. SOURCE Perognathus longimembris pacificus (Pacific pocket mouse) ORGANISM Perognathus longimembris pacificus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Castorimorpha; Heteromyidae; Perognathinae; Perognathus. COMMENT MODEL REFSEQ: This record is...
XR_007213257.1 - Perognathus longimembris pacificus (Pacific pocket mouse) - NCBI
PREDICTED: Micropterus dolomieu dicer 1, ribonuclease type III (dicer1), transcript variant X3, mRNA. (3028 bp)
lon="43.598747 N 74.970827 W" /collection_date="2019-07-10" /linkage_group="LG11" gene 1..3028 /gene="dicer1" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:123979502" CDS 401..3028 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_045919395.1" /db_xref="GeneID:123979502" /translation="...
XM_046063439.1 - Micropterus dolomieu (smallmouth bass) - NCBI
PREDICTED: Corythoichthys intestinalis dicer 1, ribonuclease type III (dicer1), transcript variant X8, misc_RNA. (2710 bp)
LOCUS XR_009067184 2710 bp RNA linear VRT 16-MAY-2024 DEFINITION PREDICTED: Corythoichthys intestinalis dicer 1, ribonuclease type III (dicer1), transcript variant X8, misc_RNA. ACCESSION XR_009067184 VERSION XR_009067184.1 DBLINK BioProject: PRJNA989181 KEYWORDS RefSeq. SOURCE Corythoichthys intestinalis (scribbled pipefish) ORGANISM Corythoichthys intestinalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Corythoichthys. COMMENT MODEL REFSEQ...
XR_009067184.1 - Corythoichthys intestinalis (scribbled pipefish) - NCBI
PREDICTED: Corythoichthys intestinalis dicer 1, ribonuclease type III (dicer1), transcript variant X6, misc_RNA. (2746 bp)
LOCUS XR_009067183 2746 bp RNA linear VRT 16-MAY-2024 DEFINITION PREDICTED: Corythoichthys intestinalis dicer 1, ribonuclease type III (dicer1), transcript variant X6, misc_RNA. ACCESSION XR_009067183 VERSION XR_009067183.1 DBLINK BioProject: PRJNA989181 KEYWORDS RefSeq. SOURCE Corythoichthys intestinalis (scribbled pipefish) ORGANISM Corythoichthys intestinalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Corythoichthys. COMMENT MODEL REFSEQ...
XR_009067183.1 - Corythoichthys intestinalis (scribbled pipefish) - NCBI
PREDICTED: Corythoichthys intestinalis dicer 1, ribonuclease type III (dicer1), transcript variant X5, misc_RNA. (5923 bp)
LOCUS XR_009067182 5923 bp RNA linear VRT 16-MAY-2024 DEFINITION PREDICTED: Corythoichthys intestinalis dicer 1, ribonuclease type III (dicer1), transcript variant X5, misc_RNA. ACCESSION XR_009067182 VERSION XR_009067182.1 DBLINK BioProject: PRJNA989181 KEYWORDS RefSeq. SOURCE Corythoichthys intestinalis (scribbled pipefish) ORGANISM Corythoichthys intestinalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Corythoichthys. COMMENT MODEL REFSEQ...
XR_009067182.1 - Corythoichthys intestinalis (scribbled pipefish) - NCBI
PREDICTED: Syngnathus scovelli dicer 1, ribonuclease type III (dicer1), transcript variant X7, misc_RNA. (2205 bp)
LOCUS XR_007485932 2205 bp RNA linear VRT 23-SEP-2024 DEFINITION PREDICTED: Syngnathus scovelli dicer 1, ribonuclease type III (dicer1), transcript variant X7, misc_RNA. ACCESSION XR_007485932 VERSION XR_007485932.2 DBLINK BioProject: PRJNA863313 KEYWORDS RefSeq. SOURCE Syngnathus scovelli (Gulf pipefish) ORGANISM Syngnathus scovelli Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Syngnathus. COMMENT MODEL REFSEQ: This record is predicted by...
XR_007485932.2 - Syngnathus scovelli (Gulf pipefish) - NCBI
PREDICTED: Lepisosteus oculatus dicer 1, ribonuclease type III (dicer1), transcript variant X3, misc_RNA. (6699 bp)
LOCUS XR_011190177 6699 bp RNA linear VRT 18-OCT-2024 DEFINITION PREDICTED: Lepisosteus oculatus dicer 1, ribonuclease type III (dicer1), transcript variant X3, misc_RNA. ACCESSION XR_011190177 VERSION XR_011190177.1 DBLINK BioProject: PRJNA1158843 KEYWORDS RefSeq. SOURCE Lepisosteus oculatus (spotted gar) ORGANISM Lepisosteus oculatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Holostei; Semionotiformes; Lepisosteidae; Lepisosteus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from...
XR_011190177.1 - Lepisosteus oculatus (spotted gar) - NCBI
PREDICTED: Heptranchias perlo dicer 1, ribonuclease type III (dicer1), transcript variant X1, misc_RNA. (6964 bp)
LOCUS XR_010964259 6964 bp RNA linear VRT 29-AUG-2024 DEFINITION PREDICTED: Heptranchias perlo dicer 1, ribonuclease type III (dicer1), transcript variant X1, misc_RNA. ACCESSION XR_010964259 VERSION XR_010964259.1 DBLINK BioProject: PRJNA1152544 KEYWORDS RefSeq. SOURCE Heptranchias perlo (sharpnose sevengill shark) ORGANISM Heptranchias perlo Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes; Elasmobranchii; Squalomorphii; Hexanchiformes; Hexanchidae; Heptranchias. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from...
XR_010964259.1 - Heptranchias perlo (sharpnose sevengill shark) - NCBI
PREDICTED: Heterodontus francisci dicer 1, ribonuclease type III (dicer1), transcript variant X8, misc_RNA. (3943 bp)
LOCUS XR_010975645 3943 bp RNA linear VRT 30-AUG-2024 DEFINITION PREDICTED: Heterodontus francisci dicer 1, ribonuclease type III (dicer1), transcript variant X8, misc_RNA. ACCESSION XR_010975645 VERSION XR_010975645.1 DBLINK BioProject: PRJNA1152550 KEYWORDS RefSeq. SOURCE Heterodontus francisci (horn shark) ORGANISM Heterodontus francisci Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes; Elasmobranchii; Galeomorphii; Heterodontoidea; Heterodontiformes; Heterodontidae; Heterodontus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This...
XR_010975645.1 - Heterodontus francisci (horn shark) - NCBI
PREDICTED: Hippoglossus stenolepis dicer 1, ribonuclease type III (dicer1), transcript variant X4, mRNA. (7698 bp)
lat_lon="51.671 N 130.70875 W" /collection_date="2004-01-15" /collected_by="IPHC" gene 1..7698 /gene="dicer1" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:118116613" CDS 271..3612 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_047197699.1" /db_xref="GeneID:118116613" /translation="...
XM_047341743.1 - Hippoglossus stenolepis (Pacific halibut) - NCBI
PREDICTED: Hippoglossus stenolepis dicer 1, ribonuclease type III (dicer1), transcript variant X2, mRNA. (7776 bp)
lat_lon="51.671 N 130.70875 W" /collection_date="2004-01-15" /collected_by="IPHC" gene 1..7776 /gene="dicer1" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns" /db_xref="GeneID:118116613" CDS 271..3612 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_047197698.1" /db_xref="GeneID:118116613" /translation="...
XM_047341742.1 - Hippoglossus stenolepis (Pacific halibut) - NCBI
PREDICTED: Chrysemys picta bellii dicer 1, ribonuclease III (DICER1), transcript variant X18, misc_RNA. (2817 bp)
LOCUS XR_006176507 2817 bp RNA linear VRT 05-JUN-2024 DEFINITION PREDICTED: Chrysemys picta bellii dicer 1, ribonuclease III (DICER1), transcript variant X18, misc_RNA. ACCESSION XR_006176507 VERSION XR_006176507.2 DBLINK BioProject: PRJNA1113615 KEYWORDS RefSeq. SOURCE Chrysemys picta bellii (western painted turtle) ORGANISM Chrysemys picta bellii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Testudinata; Testudines; Cryptodira; Durocryptodira; Testudinoidea; Emydidae; Chrysemys. COMMENT MODEL REFSEQ: This record is predicted by automated computational...
XR_006176507.2 - Chrysemys picta bellii (western painted turtle) - NCBI
PREDICTED: Hyperolius riggenbachi dicer 1, ribonuclease III (DICER1), transcript variant X3, misc_RNA. (2460 bp)
LOCUS XR_011024179 2460 bp RNA linear VRT 10-SEP-2024 DEFINITION PREDICTED: Hyperolius riggenbachi dicer 1, ribonuclease III (DICER1), transcript variant X3, misc_RNA. ACCESSION XR_011024179 VERSION XR_011024179.1 DBLINK BioProject: PRJNA1153528 KEYWORDS RefSeq. SOURCE Hyperolius riggenbachi (Riggenbach's reed frog) ORGANISM Hyperolius riggenbachi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Microhyloidea; Hyperoliidae; Hyperolius. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is...
XR_011024179.1 - Hyperolius riggenbachi (Riggenbach's reed frog) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : https://172.18.8.233:20082/Dicer
lang : en | div : | spe : | query_string : Dicer | format : html | download : 

0.000 | 0.000 | search_start;
0.313 | 0.313 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Dicer)%7C(nt:Dicer)%7C(aa:Dicer))?to=0&format=json
0.571 | 0.259 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Dicer)%7C(nt:Dicer)%7C(aa:Dicer))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.578 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]