GGRNA ver.2 Help | Advanced search | English    旧バージョン

2021-01-17 00:40:45, GGRNA : RefSeq release 203 (Nov, 2020)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1770 bp)
misc_feature order(1024..1038,1042..1044,1093..1095,1111..1113, 1150..1152,1156..1161,1168..1173,1177..1185,1189..1194) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1030..1191 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1030..1032,1039..1041,1159..1161,1168..1173, 1180..1182) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens double homeobox 5 (DUX5), mRNA. (594 bp)
DUX5" /gene_synonym="DUX1" /note="double homeobox protein; alternative translation start site; double homeobox protein 1" /codon_start=1 /product="double homeobox protein 5" /protein_id="NP_036281.2" /db_xref="GeneID:26581" /db_xref="HGNC:HGNC:3083" /db_xref="MIM:611444" /translation="MPAEVHGSPPASLCPCQSVKFRPGLPEMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQASIRCNAAPIG" misc_feature 160..297 /gene="DUX5" /gene_synonym="DUX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: DUX1
NM_012149.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens leucine twenty homeobox (LEUTX), transcript variant 2, mRNA. (969 bp)
twenty homeobox; PRD-LIKE homeobox transcription factor LEUTX; paired-like homeobox transcription factor LEUTX; paired-like homeodomain transcription factor LEUTX" /codon_start=1 /product="paired-like homeodomain transcription factor LEUTX isoform 2" /protein_id="NP_001137304.1" /db_xref="GeneID:342900" /db_xref="HGNC:HGNC:31953" /db_xref="MIM:618701" /translation="MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV" misc_feature <307..408 /gene="LEUTX" /note="Homeobox domain;...
NM_001143832.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens distal-less homeobox 4 (DLX4), transcript variant 2, mRNA. (1763 bp)
LOCUS NM_001934 1763 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens distal-less homeobox 4 (DLX4), transcript variant 2, mRNA. ACCESSION NM_001934 VERSION NM_001934.4 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 382..543 /gene="DLX4" /gene_synonym="BP1; DLX7; DLX8; DLX9; OFC15" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(382..384,391..393,511..513,520..525,532..534) /gene="DLX4" /gene_...
Synonym: BP1; DLX7; DLX8; DLX9; OFC15
NM_001934.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens motor neuron and pancreas homeobox 1 (MNX1), transcript variant 2, mRNA. (1619 bp)
LOCUS NM_001165255 1619 bp mRNA linear PRI 01-NOV-2020 DEFINITION Homo sapiens motor neuron and pancreas homeobox 1 (MNX1), transcript variant 2, mRNA. ACCESSION NM_001165255 VERSION NM_001165255.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 477..638 /gene="MNX1" /gene_synonym="HB9; HLXB9; HOXHB9; SCRA1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(477..479,486..488,606..608,615..620,627..629) /gene="MNX1" /gene_...
Synonym: HB9; HLXB9; HOXHB9; SCRA1
NM_001165255.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens double homeobox 1 (DUX1), mRNA. (1227 bp)
map="10" gene 1..1227 /gene="DUX1" /note="double homeobox 1" /db_xref="GeneID:26584" /db_xref="HGNC:HGNC:3079" /db_xref="MIM:611441" CDS 113..625 /gene="DUX1" /codon_start=1 /product="double homeobox protein 1" /protein_id="NP_036278.1" /db_xref="GeneID:26584" /db_xref="HGNC:HGNC:3079" /db_xref="MIM:611441" /translation="MALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQASIRCNAAPIG" misc_feature 191..328 /gene="DUX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
NM_012146.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox C5 (HOXC5), transcript variant 1, mRNA. (1611 bp)
LOCUS NM_018953 1611 bp mRNA linear PRI 23-OCT-2020 DEFINITION Homo sapiens homeobox C5 (HOXC5), transcript variant 1, mRNA. ACCESSION NM_018953 VERSION NM_018953.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 545..706 /gene="HOXC5" /gene_synonym="CP11; HOX3; HOX3D" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(545..547,554..556,674..676,683..688,695..697) /gene="HOXC5" /gene_...
Synonym: CP11; HOX3; HOX3D
NM_018953.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA. (1818 bp)
LOCUS NM_001098834 1818 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA. ACCESSION NM_001098834 VERSION NM_001098834.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...Huh-17" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 936..1097 /gene="GBX1" /gene_synonym="Huh-17" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(936..938,945..947,1065..1067,1074..1079,1086..1088) /gene="GBX1" /gene_...
Synonym: Huh-17
NM_001098834.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens H6 family homeobox 2 (HMX2), mRNA. (1614 bp)
LOCUS NM_005519 1614 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens H6 family homeobox 2 (HMX2), mRNA. ACCESSION NM_005519 XM_370580 VERSION NM_005519.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 697..858 /gene="HMX2" /gene_synonym="H6L; Nkx5-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(697..699,706..708,826..828,835..840,847..849) /gene="HMX2" /gene_synonym="...
Synonym: H6L; Nkx5-2
NM_005519.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox B2 (HOXB2), mRNA. (1682 bp)
LOCUS NM_002145 1682 bp mRNA linear PRI 01-NOV-2020 DEFINITION Homo sapiens homeobox B2 (HOXB2), mRNA. ACCESSION NM_002145 VERSION NM_002145.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...; other site" /db_xref="CDD:238039" misc_feature 637..795 /gene="HOXB2" /gene_synonym="Hox-2.8; HOX2; HOX2H; K8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 1018..1020 /gene="HOXB2" /gene_synonym="Hox-2.8; HOX2; HOX2H; K8" /note="...
Synonym: Hox-2.8; HOX2; HOX2H; K8
NM_002145.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox B5 (HOXB5), mRNA. (1859 bp)
LOCUS NM_002147 1859 bp mRNA linear PRI 23-OCT-2020 DEFINITION Homo sapiens homeobox B5 (HOXB5), mRNA. ACCESSION NM_002147 VERSION NM_002147.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...; other site" /db_xref="CDD:238039" misc_feature 689..850 /gene="HOXB5" /gene_synonym="HHO.C10; HOX2; Hox2.1; HOX2A; HU-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" exon 660..1859 /gene="HOXB5" /gene_synonym="HHO.C10; HOX2; Hox2.1; HOX2A; HU-1" /inference="...
Synonym: HHO.C10; HOX2; Hox2.1; HOX2A; HU-1
NM_002147.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens zinc fingers and homeoboxes 1 (ZHX1), transcript variant 3, non-coding RNA. (5031 bp)
LOCUS NR_037873 5031 bp RNA linear PRI 18-SEP-2020 DEFINITION Homo sapiens zinc fingers and homeoboxes 1 (ZHX1), transcript variant 3, non-coding RNA. ACCESSION NR_037873 VERSION NR_037873.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK289532.1, AF106862.1, CA776642.1, BC040481.1 and AK025236.1. On...
NR_037873.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox B3 (HOXB3), transcript variant 6, mRNA. (2851 bp)
LOCUS NM_001384750 2851 bp mRNA linear PRI 16-SEP-2020 DEFINITION Homo sapiens homeobox B3 (HOXB3), transcript variant 6, mRNA. ACCESSION NM_001384750 VERSION NM_001384750.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC103702.3. Summary: This gene is a member of the Antp homeobox family and encodes a...
Synonym: Hox-2.7; HOX2; HOX2G
NM_001384750.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox B3 (HOXB3), transcript variant 4, mRNA. (2890 bp)
LOCUS NM_001384747 2890 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox B3 (HOXB3), transcript variant 4, mRNA. ACCESSION NM_001384747 VERSION NM_001384747.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC103702.3. Summary: This gene is a member of the Antp homeobox family and encodes a...
Synonym: Hox-2.7; HOX2; HOX2G
NM_001384747.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens leucine twenty homeobox (LEUTX), transcript variant 1, mRNA. (820 bp)
LOCUS NM_001382345 820 bp mRNA linear PRI 23-OCT-2020 DEFINITION Homo sapiens leucine twenty homeobox (LEUTX), transcript variant 1, mRNA. ACCESSION NM_001382345 VERSION NM_001382345.1 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC005393.1. ##Evidence-Data-START##...
NM_001382345.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox B3 (HOXB3), transcript variant 5, mRNA. (3301 bp)
LOCUS NM_001384749 3301 bp mRNA linear PRI 12-SEP-2020 DEFINITION Homo sapiens homeobox B3 (HOXB3), transcript variant 5, mRNA. ACCESSION NM_001384749 XM_005257277 VERSION NM_001384749.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC103702.3. On Jun 26, 2020 this sequence version...
Synonym: Hox-2.7; HOX2; HOX2G
NM_001384749.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 1, mRNA. (2437 bp)
LOCUS NM_030661 2437 bp mRNA linear PRI 16-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 1, mRNA. ACCESSION NM_030661 VERSION NM_030661.5 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 783..941 /gene="HOXA3" /gene_synonym="HOX1; HOX1E" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 1329..1523 /gene="HOXA3" /gene_synonym="HOX1; HOX1E" /note="Domain of...
Synonym: HOX1; HOX1E
NM_030661.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens NK2 homeobox 6 (NKX2-6), mRNA. (1775 bp)
LOCUS NM_001136271 1775 bp mRNA linear PRI 12-SEP-2020 DEFINITION Homo sapiens NK2 homeobox 6 (NKX2-6), mRNA. ACCESSION NM_001136271 XM_001716458 XM_070619 XM_939389 VERSION NM_001136271.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC012574.7. On Jun 3, 2020 this sequence version...
Synonym: CSX2; CTHM; NKX2F; NKX4-2
NM_001136271.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 4, mRNA. (2290 bp)
Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:389985" misc_feature order(1634..1648,1652..1654,1703..1705,1721..1723, 1760..1762,1766..1771,1778..1783,1787..1795,1799..1804) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1640..1804 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order...
Synonym: Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
NM_001285986.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 11, mRNA. (2507 bp)
LOCUS NM_001384344 2507 bp mRNA linear PRI 16-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 11, mRNA. ACCESSION NM_001384344 VERSION NM_001384344.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding the class of...
Synonym: HOX1; HOX1E
NM_001384344.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 12, mRNA. (2581 bp)
LOCUS NM_001384343 2581 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 12, mRNA. ACCESSION NM_001384343 VERSION NM_001384343.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding the class of...
Synonym: HOX1; HOX1E
NM_001384343.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 13, mRNA. (2568 bp)
LOCUS NM_001384345 2568 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 13, mRNA. ACCESSION NM_001384345 XM_005249732 VERSION NM_001384345.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC004079.1. On Jun 16, 2020 this sequence version replaced XM...
Synonym: HOX1; HOX1E
NM_001384345.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 14, mRNA. (2575 bp)
LOCUS NM_001384346 2575 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 14, mRNA. ACCESSION NM_001384346 XM_005249731 VERSION NM_001384346.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC004079.1. On Jun 17, 2020 this sequence version replaced XM...
Synonym: HOX1; HOX1E
NM_001384346.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 2, mRNA. (3026 bp)
LOCUS NM_153631 3026 bp mRNA linear PRI 16-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 2, mRNA. ACCESSION NM_153631 XM_005249730 VERSION NM_153631.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1372..1530 /gene="HOXA3" /gene_synonym="HOX1; HOX1E" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 1918..2112 /gene="HOXA3" /gene_synonym="HOX1; HOX1E" /note="Domain of...
Synonym: HOX1; HOX1E
NM_153631.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens HESX homeobox 1 (HESX1), transcript variant 5, mRNA. (1877 bp)
LOCUS NM_001376061 1877 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens HESX homeobox 1 (HESX1), transcript variant 5, mRNA. ACCESSION NM_001376061 XM_011534204 VERSION NM_001376061.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1291..1455 /gene="HESX1" /gene_synonym="ANF; CPHD5; RPX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(1291..1293,1300..1302,1420..1422,1429..1434, 1441..1443) /gene="...
Synonym: ANF; CPHD5; RPX
NM_001376061.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 9, mRNA. (2696 bp)
LOCUS NM_001384341 2696 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 9, mRNA. ACCESSION NM_001384341 VERSION NM_001384341.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding the class of...
Synonym: HOX1; HOX1E
NM_001384341.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 10, mRNA. (2599 bp)
LOCUS NM_001384342 2599 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 10, mRNA. ACCESSION NM_001384342 VERSION NM_001384342.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding the class of...
Synonym: HOX1; HOX1E
NM_001384342.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 6, mRNA. (2598 bp)
LOCUS NM_001384338 2598 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 6, mRNA. ACCESSION NM_001384338 VERSION NM_001384338.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC004080.2, AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding...
Synonym: HOX1; HOX1E
NM_001384338.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 8, mRNA. (2783 bp)
LOCUS NM_001384340 2783 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 8, mRNA. ACCESSION NM_001384340 VERSION NM_001384340.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC004080.2, AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding...
Synonym: HOX1; HOX1E
NM_001384340.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 4, mRNA. (3188 bp)
LOCUS NM_001384336 3188 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 4, mRNA. ACCESSION NM_001384336 VERSION NM_001384336.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC004080.2, AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding...
Synonym: HOX1; HOX1E
NM_001384336.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 7, mRNA. (3426 bp)
LOCUS NM_001382329 3426 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 7, mRNA. ACCESSION NM_001382329 VERSION NM_001382329.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...misc_feature 296..553 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order(875..889,893..895,953..955,971..973,1010..1012, 1016..1021,1028..1033,1037..1045) /gene="PKNOX2" /gene_synonym="PREP2" /...
Synonym: PREP2
NM_001382329.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 7, mRNA. (2899 bp)
LOCUS NM_001384339 2899 bp mRNA linear PRI 17-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 7, mRNA. ACCESSION NM_001384339 VERSION NM_001384339.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC004080.2, AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding...
Synonym: HOX1; HOX1E
NM_001384339.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 5, mRNA. (3071 bp)
LOCUS NM_001384337 3071 bp mRNA linear PRI 16-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 5, mRNA. ACCESSION NM_001384337 VERSION NM_001384337.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC004080.2, AC010990.3 and AC004079.1. Summary: In vertebrates, the genes encoding...
Synonym: HOX1; HOX1E
NM_001384337.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 8, mRNA. (3462 bp)
LOCUS NM_001382330 3462 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 8, mRNA. ACCESSION NM_001382330 VERSION NM_001382330.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...misc_feature 332..589 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order(911..925,929..931,989..991,1007..1009,1046..1048, 1052..1057,1064..1069,1073..1081) /gene="PKNOX2" /gene_synonym="...
Synonym: PREP2
NM_001382330.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 10, mRNA. (3533 bp)
LOCUS NM_001382332 3533 bp mRNA linear PRI 23-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 10, mRNA. ACCESSION NM_001382332 VERSION NM_001382332.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...misc_feature 403..660 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order(982..996,1000..1002,1060..1062,1078..1080, 1117..1119,1123..1128,1135..1140,1144..1152) /gene="PKNOX2" /gene_synonym="...
Synonym: PREP2
NM_001382332.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 9, mRNA. (3646 bp)
LOCUS NM_001382331 3646 bp mRNA linear PRI 23-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 9, mRNA. ACCESSION NM_001382331 VERSION NM_001382331.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...misc_feature 516..773 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order(1095..1109,1113..1115,1173..1175,1191..1193, 1230..1232,1236..1241,1248..1253,1257..1265) /gene="PKNOX2" /gene_synonym="...
Synonym: PREP2
NM_001382331.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens caudal type homeobox 4 (CDX4), mRNA. (1642 bp)
LOCUS NM_005193 1642 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens caudal type homeobox 4 (CDX4), mRNA. ACCESSION NM_005193 VERSION NM_005193.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi...gene="CDX4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 730..888 /gene="CDX4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" exon 704..849 /gene="CDX4" /inference="alignment:Splign:2.1.0" exon 850..1642 /gene="...
NM_005193.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 3, mRNA. (1579 bp)
to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:304656" misc_feature 821..823 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="OCT4B-164; Region: Alternative start codon" misc_feature order(923..937,941..943,992..994,1010..1012,1049..1051, 1055..1060,1067..1072,1076..1084,1088..1093) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 929..1090 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="Homeobox domain; Region:...
Synonym: Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
NM_001173531.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens Meis homeobox 2 (MEIS2), transcript variant f, mRNA. (4886 bp)
LOCUS NM_002399 4886 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens Meis homeobox 2 (MEIS2), transcript variant f, mRNA. ACCESSION NM_002399 VERSION NM_002399.4 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi...misc_feature 736..990 /gene="MEIS2" /gene_synonym="CPCMR; HsT18361; MRG1" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order(1252..1254,1381..1383,1390..1395,1402..1404) /gene="MEIS2" /gene_synonym="CPCMR; HsT18361; MRG1" /note="...
Synonym: CPCMR; HsT18361; MRG1
NM_002399.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens homeobox A3 (HOXA3), transcript variant 3, mRNA. (3142 bp)
LOCUS NM_001384335 3142 bp mRNA linear PRI 16-SEP-2020 DEFINITION Homo sapiens homeobox A3 (HOXA3), transcript variant 3, mRNA. ACCESSION NM_001384335 XM_006715715 VERSION NM_001384335.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC004080.2, AC010990.3 and AC004079.1. On Jun 16, 2020 this sequence...
Synonym: HOX1; HOX1E
NM_001384335.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 2, mRNA. (2065 bp)
to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:304656" misc_feature 1307..1309 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="OCT4B-164; Region: Alternative start codon" misc_feature order(1409..1423,1427..1429,1478..1480,1496..1498, 1535..1537,1541..1546,1553..1558,1562..1570,1574..1579) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1415..1576 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4" /note="Homeobox domain;...
Synonym: Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
NM_203289.6 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 5, mRNA. (3571 bp)
LOCUS NM_001382327 3571 bp mRNA linear PRI 23-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 5, mRNA. ACCESSION NM_001382327 VERSION NM_001382327.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...acetyl-CoA carboxylase; Region: PLN02983" /db_xref="CDD:215533" misc_feature 441..698 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order...
Synonym: PREP2
NM_001382327.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 3, mRNA. (3535 bp)
LOCUS NM_001382325 3535 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 3, mRNA. ACCESSION NM_001382325 VERSION NM_001382325.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...acetyl-CoA carboxylase; Region: PLN02983" /db_xref="CDD:215533" misc_feature 405..662 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order...
Synonym: PREP2
NM_001382325.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 4, mRNA. (3644 bp)
LOCUS NM_001382326 3644 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 4, mRNA. ACCESSION NM_001382326 VERSION NM_001382326.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...acetyl-CoA carboxylase; Region: PLN02983" /db_xref="CDD:215533" misc_feature 514..771 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order...
Synonym: PREP2
NM_001382326.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 2, mRNA. (3715 bp)
LOCUS NM_001382324 3715 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 2, mRNA. ACCESSION NM_001382324 VERSION NM_001382324.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...acetyl-CoA carboxylase; Region: PLN02983" /db_xref="CDD:215533" misc_feature 585..842 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order...
Synonym: PREP2
NM_001382324.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens Meis homeobox 2 (MEIS2), transcript variant h, mRNA. (4649 bp)
roduct="homeobox protein Meis2 isoform h" /protein_id="NP_758527.1" /db_xref="CCDS:CCDS45220.1" /db_xref="GeneID:4212" /db_xref="HGNC:HGNC:7001" /db_xref="MIM:601740" /translation="MALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM" misc_feature 499..753 /gene="MEIS2" /gene_synonym="CPCMR; HsT18361; MRG1" /note="N-terminal of Homeobox Meis...
Synonym: CPCMR; HsT18361; MRG1
NM_172316.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 6, mRNA. (3755 bp)
LOCUS NM_001382328 3755 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 6, mRNA. ACCESSION NM_001382328 VERSION NM_001382328.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...acetyl-CoA carboxylase; Region: PLN02983" /db_xref="CDD:215533" misc_feature 625..882 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order...
Synonym: PREP2
NM_001382328.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens TGFB induced factor homeobox 2 (TGIF2), transcript variant 3, mRNA. (3328 bp)
LOCUS NM_001199513 3328 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens TGFB induced factor homeobox 2 (TGIF2), transcript variant 3, mRNA. ACCESSION NM_001199513 VERSION NM_001199513.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...TGIF2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 201..320 /gene="TGIF2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:310480" misc_feature 402..806 /gene="TGIF2" /note="propagated from UniProtKB/Swiss-Prot...
NM_001199513.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens TGFB induced factor homeobox 2 (TGIF2), transcript variant 4, mRNA. (3388 bp)
LOCUS NM_001199515 3388 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens TGFB induced factor homeobox 2 (TGIF2), transcript variant 4, mRNA. ACCESSION NM_001199515 VERSION NM_001199515.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...TGIF2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 261..380 /gene="TGIF2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:310480" misc_feature 462..866 /gene="TGIF2" /note="propagated from UniProtKB/Swiss-Prot...
NM_001199515.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 1, mRNA. (3642 bp)
LOCUS NM_001382323 3642 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant 1, mRNA. ACCESSION NM_001382323 VERSION NM_001382323.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata;...acetyl-CoA carboxylase; Region: PLN02983" /db_xref="CDD:215533" misc_feature 512..769 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:374576" misc_feature order...
Synonym: PREP2
NM_001382323.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/hs/homeobox
lang : ja | div : | spe : hs | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.121 | 0.121 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Homo sapiens (human)?to=0&format=json
0.277 | 0.155 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Homo sapiens (human)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.282 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]