GGRNA ver.2 Help | Advanced search | English    旧バージョン

2020-04-07 22:12:26, GGRNA : RefSeq release 99 (Mar, 2020)




Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1944 bp)
DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. ACCESSION NM_001185023 VERSION NM_001185023.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
FEB-2020 DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. ACCESSION NM_001185022 VERSION NM_001185022.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ011497.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (1542 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.6 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
us claudin 11 (Cldn11), mRNA. ACCESSION NM_008770 VERSION NM_008770.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: Claudin-11; Claudin11; Osp; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis claudin 1 (cldn1), mRNA. (2770 bp)
CDS 152..787 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /note="Xclaudin 1" /codon_start=1 /product="claudin-1" /protein_id="NP_001015704.1" /db_xref="GeneID:548421" /db_xref="Xenbase:XB-GENE-951609" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKTYDSLLKLDSTMQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGNKIAKDFYNVFTPTNSKYEFGPALFIGWAGAALAILGGALLCCSCPRRETSYPPPRGYNKSAPPAGKDYV" misc_feature 164..697 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-1; cld1; ilvasc; semp1
NM_001015704.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis claudin 8, gene 4 (cldn8.4), mRNA. (2062 bp)
gene_synonym="claudin-8" /inference="alignment:Splign:2.0.8" CDS 31..711 /gene="cldn8.4" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.4" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Rattus norvegicus claudin 19 (Cldn19), mRNA. (1626 bp)
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-19
NM_001008514.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Macaca mulatta claudin 3 (CLDN3), mRNA. (1062 bp)
CLDN3" /gene_synonym="claudin-3" /note="upstream in-frame stop codon" CDS 379..1041 /gene="CLDN3" /gene_synonym="claudin-3" /codon_start=1 /product="claudin-3" /protein_id="NP_001181491.1" /db_xref="GeneID:716771" /db_xref="VGNC:VGNC:71250" /translation="MSMGLEITGTALAVLGWLGTIVCCALPMWRVTAFIGSNIITSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSANTIIREFYNPVVPEAQKREMGTSLYVGWAAAALQLLGGALLCCSCPPREKKYMPTKVVYSAPRSTGPGASMGTAYDRKDYV" misc_feature 385..879 /gene="CLDN3" /gene_synonym="claudin-3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin...
Synonym: claudin-3
NM_001194562.2 - Macaca mulatta (Rhesus monkey) - NCBI
Mus musculus claudin 16 (Cldn16), mRNA. (1173 bp)
musculus claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins are...
Synonym: claudin-16; PCLN1
NM_053241.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Macaca mulatta claudin 9 (CLDN9), mRNA. (654 bp)
alignments. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-654 QNVO02000290.1 27410709-27411362 c FEATURES Location/Qualifiers source 1..654 /organism="Macaca mulatta" /mol_type="mRNA" /db_xref="taxon:9544" /chromosome="20" /map="20" gene 1..654 /gene="CLDN9" /gene_synonym="Claudin-9" /note="claudin 9" /db_xref="GeneID:699721" CDS 1..654 /gene="CLDN9" /gene_synonym="Claudin-9" /codon_start=1 /product="claudin-9" /protein_id="NP_001180758.1" /db_xref="GeneID:699721" /translation="...
Synonym: Claudin-9
NM_001193829.2 - Macaca mulatta (Rhesus monkey) - NCBI
Xenopus tropicalis claudin 12 (cldn12), mRNA. (2983 bp)
LOCUS NM_001016851 2983 bp mRNA linear VRT 23-DEC-2019 DEFINITION Xenopus tropicalis claudin 12 (cldn12), mRNA. ACCESSION NM_001016851 NM_001015839 VERSION NM_001016851.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CR855430.2. On or before Oct 7, 2010 this sequence...
Synonym: claudin-12
NM_001016851.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Macaca mulatta claudin 1 (CLDN1), mRNA. (2080 bp)
gene="CLDN1" /gene_synonym="claudin-1" /note="upstream in-frame stop codon" CDS 270..905 /gene="CLDN1" /gene_synonym="claudin-1" /codon_start=1 /product="claudin-1" /protein_id="NP_001180898.1" /db_xref="GeneID:704330" /db_xref="VGNC:VGNC:71242" /translation="MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGVIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV" misc_feature 282..788 /gene="CLDN1" /gene_synonym="claudin-1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-1
NM_001193969.1 - Macaca mulatta (Rhesus monkey) - NCBI
Macaca mulatta claudin 12 (CLDN12), mRNA. (2310 bp)
LOCUS NM_001194860 2310 bp mRNA linear PRI 12-DEC-2019 DEFINITION Macaca mulatta claudin 12 (CLDN12), mRNA. ACCESSION NM_001194860 XM_002803388 VERSION NM_001194860.2 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from QNVO02000313.1. On Dec 12, 2019 this...
Synonym: claudin-12
NM_001194860.2 - Macaca mulatta (Rhesus monkey) - NCBI
PREDICTED: Xenopus tropicalis claudin 8, gene 4 (cldn8.4), transcript variant X1, mRNA. (2268 bp)
LOCUS XM_031895692 2268 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis claudin 8, gene 4 (cldn8.4), transcript variant X1, mRNA. ACCESSION XM_031895692 VERSION XM_031895692.1 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-8
XM_031895692.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Xenopus tropicalis claudin 12 (cldn12), transcript variant X4, mRNA. (3000 bp)
LOCUS XM_018094662 3000 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis claudin 12 (cldn12), transcript variant X4, mRNA. ACCESSION XM_018094662 VERSION XM_018094662.2 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-12
XM_018094662.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Xenopus tropicalis claudin 12 (cldn12), transcript variant X3, mRNA. (3133 bp)
LOCUS XM_012964740 3133 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis claudin 12 (cldn12), transcript variant X3, mRNA. ACCESSION XM_012964740 VERSION XM_012964740.3 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-12
XM_012964740.3 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Xenopus tropicalis claudin 12 (cldn12), transcript variant X2, mRNA. (3152 bp)
LOCUS XM_012964739 3152 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis claudin 12 (cldn12), transcript variant X2, mRNA. ACCESSION XM_012964739 VERSION XM_012964739.3 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-12
XM_012964739.3 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Xenopus tropicalis claudin 12 (cldn12), transcript variant X1, mRNA. (3359 bp)
LOCUS XM_012964738 3359 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis claudin 12 (cldn12), transcript variant X1, mRNA. ACCESSION XM_012964738 VERSION XM_012964738.3 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-12
XM_012964738.3 - Xenopus tropicalis (tropical clawed frog) - NCBI
Danio rerio claudin 7b (cldn7b), mRNA. (1950 bp)
synonym="cb388; claudin7; cldn7; fd19f08; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 165..701 /gene="cldn7b" /gene_synonym="cb388; claudin7; cldn7; fd19f08; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: cb388; claudin7; cldn7; fd19f08; wu:fd19f08
NM_131637.1 - Danio rerio (zebrafish) - NCBI - UCSC
Rattus norvegicus claudin 4 (Cldn4), mRNA. (1824 bp)
gene="Cldn4" /note="upstream in-frame stop codon" CDS 192..824 /gene="Cldn4" /codon_start=1 /product="claudin-4" /protein_id="NP_001012022.1" /db_xref="GeneID:304407" /db_xref="RGD:1307932" /translation="MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV" misc_feature 201..701 /gene="Cldn4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1 (bases 1 to 1824) AUTHORS Berndt...
NM_001012022.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Canis lupus familiaris claudin 2 (CLDN2), mRNA. (953 bp)
roduct="claudin-2" /protein_id="NP_001003089.1" /db_xref="GeneID:403649" /db_xref="VGNC:VGNC:39316" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 80..142 /gene="CLDN2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1); transmembrane region" misc_feature 125..601 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family...
NM_001003089.1 - Canis lupus familiaris (dog) - NCBI
Rattus norvegicus claudin 5 (Cldn5), mRNA. (1442 bp)
gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" exon 1..1427 /gene="Cldn5" /inference="alignment:Splign:2.0.8" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV" misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_031701.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 1-like (LOC396566), mRNA. (1012 bp)
gene="LOC396566" /note="claudin 1-like" /db_xref="GeneID:396566" misc_feature 34..36 /gene="LOC396566" /note="upstream in-frame stop codon" CDS 175..810 /gene="LOC396566" /codon_start=1 /product="claudin-1-like" /protein_id="NP_001155107.1" /db_xref="GeneID:396566" /translation="MANAGLQLLGFILAFLGWIGSIVSTALLQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATARYGNRIVQEFYHLMTPVNARYEFGQALFTGWAAASLCLLGGALLCRSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 187..693 /gene="LOC396566" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_001161635.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus claudin 3 (Cldn3), mRNA. (1501 bp)
stop codon" CDS 441..1100 /gene="Cldn3" /note="RVP1; ventral prostate.1 protein" /codon_start=1 /product="claudin-3" /protein_id="NP_113888.2" /db_xref="GeneID:65130" /db_xref="RGD:68425" /translation="MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALLCCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV" misc_feature 447..941 /gene="Cldn3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" misc_feature 465..527 /gene="Cldn3" /experiment...
NM_031700.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 22 (CLDN22), mRNA. (681 bp)
chromosome="15" /map="15" gene 1..681 /gene="CLDN22" /note="claudin 22" /db_xref="GeneID:100294683" CDS 12..668 /gene="CLDN22" /codon_start=1 /product="claudin-22" /protein_id="NP_001153557.1" /db_xref="GeneID:100294683" /translation="MALVFRAVAQLAGILLSLLGWVLSCLTNYLPQWKNLNLDLNEMENWTMGLWQTCVIQEEVGWQCKDFDSFLALPAELRISRVLMFLSNGLGFLGLLVSGLGLDCLRIGETQQDVKKRLLILGGVLSWTAGIAALVPVSWVAHVTVQEFWDETLSEVVPRWEFGDALFIGWFAGFFLLLGGCLLSWAACGTRAPLASGHYAVVETGHHRVHPEMKTTHL" misc_feature 39..527 /gene="CLDN22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
NM_001160085.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus claudin 20 (Cldn20), mRNA. (660 bp)
CDS 1..660 /gene="Cldn20" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001102864.1" /db_xref="GeneID:680178" /db_xref="RGD:1595446" /translation="MASAGLQLLAFILAVSGVSGVLAATLLPNWKVNADAGSTIVTAIVQVHGLWMDCTWYSTGMFSCTLKYSILSLPVYVQAARATMVLACILSALGICTAIVGMKCTHLGGDAHTKSHISFAGGVCFITAGISALIPTVWYTKEIISNFLDLTVPESHKYEPGGAVYIGFISAMLLLIAGIIFCISYIKKNQEPWIYPPKQRLTSTWQPKNRLAYNLKDYV" sig_peptide 1..69 /gene="Cldn20" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 13..543 /gene="Cldn20" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001109394.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 1 S homeolog (cldn1.S), mRNA. (1465 bp)
cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /note="Xclaudin 1" /codon_start=1 /product="claudin 1 S homeolog" /protein_id="NP_001079445.1" /db_xref="GeneID:379132" /db_xref="Xenbase:XB-GENE-951614" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKSFDSLLKLDSTIQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGDKIAKDFYNMFTPTNSKYEFGPALFIGWAGAALAIIGGALLCCSCPRKETSYPPPRGYNKSAPPAGKDYV" misc_feature 163..696 /gene="cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-1; cld1; cldn1; ilvasc; semp1
NM_001085976.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 18 L homeolog (cldn18.L), mRNA. (2388 bp)
gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /codon_start=1 /product="claudin 18 L homeolog" /protein_id="NP_001083443.1" /db_xref="GeneID:398928" /db_xref="Xenbase:XB-GENE-991174" /translation="MSVTMCQTMGFLVSALGFAGIIAATALDPWSTQDLYDNPVTAVFQYQGLWKSCVQQSSGFTECRPYYTILGLPAMFQAVRALMIVGIVLGAIGLLVAIFSLKCIRIGNMEDSAKANITLTSGIMFILAGLCSIIGVSVFANMLITNFWMTTANMYTGGAISGMGGMGGLQTLQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLMPEESNYKAVSYHVSTKTPGYKTSAYEDKSKKSIYNESRRSEDGKSYPSKYDYV" misc_feature 102..677 /gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-18; cldn18
NM_001089974.1 - Xenopus laevis (African clawed frog) - NCBI
Sus scrofa claudin 7 (CLDN7), mRNA. (986 bp)
CDS 173..808 /gene="CLDN7" /codon_start=1 /product="claudin-7 precursor" /protein_id="NP_001153548.1" /db_xref="GeneID:100127486" /db_xref="VGNC:VGNC:97930" /translation="MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKTYDSVLALSAALQATRALMVVSLVLGLMAMFVGTMGMKCTNCGGDDKVKKARIAMTGGIIFIVAGLCALIACSWYGHQIVTDFYNPLVPTNVKYEFGPAIFIGWAGSSLVLLGGALLSCSCPGSEGQSGYRAPRSYPKPNSAKEYV" sig_peptide 173..244 /gene="CLDN7" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 182..718 /gene="CLDN7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /db_xref="CDD...
NM_001160076.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 6 (CLDN6), mRNA. (746 bp)
note="claudin 6" /db_xref="GeneID:100302020" /db_xref="VGNC:VGNC:86739" exon 1..746 /gene="CLDN6" /inference="alignment:Splign:2.1.0" CDS 19..684 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="NP_001155117.1" /db_xref="GeneID:100302020" /db_xref="VGNC:VGNC:86739" /translation="MASAGLQILGIVLTLFGWVNALVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLSGAKCTTCVEDKDTKARLVLTSGIIFVLSGVLTLIPVCWTAHAIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGRSQGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 31..528 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region:...
NM_001161645.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 8 (CLDN8), mRNA. (777 bp)
note="claudin 8" /db_xref="GeneID:100302021" /db_xref="VGNC:VGNC:86740" exon 1..777 /gene="CLDN8" /inference="alignment:Splign:2.1.0" CDS 59..736 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="NP_001155118.1" /db_xref="GeneID:100302021" /db_xref="VGNC:VGNC:86740" /translation="MASNALQIAGLVLGGVGMVGTVAVTVMPQWRVSAFIGSNIVVFENLWEGLWMNCMRHANIRMQCKIYDSLLALSPDLQASRGLMCTASVLSFLAFMTAILGMKCTRCTSDDEKVKSYILLTAGVLFVLTGFVVLIPVSWVANSIIRDFYNPIVDIAQKRELGEALYIGWTAALVLIAAGALFCCIFCCSERSHSYRYSIPSHRTTQRSYHMEKKSPSVYSRSQYV" misc_feature 71..604 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family;...
NM_001161646.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 20 (CLDN20), mRNA. (744 bp)
CLDN20" /note="claudin 20" /db_xref="GeneID:100153817" CDS 28..687 /gene="CLDN20" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001153249.1" /db_xref="GeneID:100153817" /translation="MASAGLQLLAFALALSGVSGVLTATLLPNWKVNVDAGSNIITAIVQLQGLWMDCTWYSTGMFSCSLKDSVLGLPTHVQAARAAMVLACVLSALGICTCTVGMKCTRLGGDRESKSHTCFAGGVCLVSAGISSLTPTVWYTKEIIANFLDLTVPESNKHEPGGAVYIGFISAMLLFISGLIFCTSCVKKRAEALLYPSKQQHIPISQPEDNSAYSLKDYV" sig_peptide 28..87 /gene="CLDN20" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 76..570 /gene="CLDN20" /note="PMP-22/EMP/MP20/Claudin family; Region:...
NM_001159777.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 9 (CLDN9), mRNA. (1178 bp)
gene="CLDN9" /note="upstream in-frame stop codon" CDS 209..862 /gene="CLDN9" /codon_start=1 /product="claudin-9" /protein_id="NP_001155119.1" /db_xref="GeneID:100302022" /db_xref="VGNC:VGNC:86741" /translation="MASAGLELLGMSLAVLGWLGTLVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCAVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVVLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAASALLMLGGGLLCCTCPPPQIDRPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 221..724 /gene="CLDN9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
NM_001161647.1 - Sus scrofa (pig) - NCBI
Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA. (2908 bp)
ynonym="claudin-3; cldn3" /note="upstream in-frame stop codon" CDS 376..1017 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /codon_start=1 /product="claudin 3 L homeolog" /protein_id="NP_001087400.1" /db_xref="GeneID:447224" /db_xref="Xenbase:XB-GENE-6078310" /translation="MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV" misc_feature 382..915 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /note="PMP-22/EMP/MP20/Claudin family...
Synonym: claudin-3; cldn3
NM_001093931.1 - Xenopus laevis (African clawed frog) - NCBI
Rattus norvegicus claudin 1 (Cldn1), mRNA. (3275 bp)
gene="Cldn1" /note="claudin 1" /db_xref="GeneID:65129" /db_xref="RGD:68422" exon 1..402 /gene="Cldn1" /inference="alignment:Splign:2.0.8" CDS 180..815 /gene="Cldn1" /codon_start=1 /product="claudin-1" /protein_id="NP_113887.2" /db_xref="GeneID:65129" /db_xref="RGD:68422" /translation="MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFVISGLATLVATAWYGNRIVQEFYDPMTPINARYEFGQALFTGWAAASLCLLGGALLSCSCPRKTTSYPTPRPYPKPTPSTGKDYV" misc_feature 192..725 /gene="Cldn1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_031699.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 14 L homeolog (cldn14.L), mRNA. (1338 bp)
gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /codon_start=1 /product="claudin 14 L homeolog" /protein_id="NP_001086045.1" /db_xref="GeneID:444474" /db_xref="Xenbase:XB-GENE-995701" /translation="MASMALQLLGFSVALIGFIGTVVATVLPHWWRTAHVGTNIITAVAYMKGLWMECVWHSTGIYQCQVHQSQLALPRDLQVARAMMVASCVLSVLASVVSVFGMKCTQCAKGSSSKRVIAAFGGVFSALAGLMCLIPVAWSTNDVVQDFYNPGLPYGMKYEIGQALYIGFISGGLSVIGGIMILSTSCQKDSTPLPYTPQRRYPRKTPTSRSQPVNKSNHVPSWSSASHHGYHLNDFV" misc_feature 70..600 /gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-14; cldn14; DFNB29
NM_001092576.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Rattus norvegicus claudin 2 (Cldn2), mRNA. (3052 bp)
CDS 349..1041 /gene="Cldn2" /gene_synonym="RGD1560247" /codon_start=1 /product="claudin-2" /protein_id="NP_001100316.1" /db_xref="GeneID:300920" /db_xref="RGD:1560247" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV" misc_feature 361..891 /gene="Cldn2" /gene_synonym="RGD1560247" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" ORIGIN // REFERENCE 1...
Synonym: RGD1560247
NM_001106846.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 19 S homeolog (cldn19.S), mRNA. (1944 bp)
"claudin-19; cldn19" /note="upstream in-frame stop codon" CDS 309..974 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /codon_start=1 /product="claudin 19 S homeolog" /protein_id="NP_001088886.1" /db_xref="GeneID:496231" /db_xref="Xenbase:XB-GENE-954660" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIAVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNDERRGQQYYRQSQPSATTREITKMPAKNKEETS" misc_feature 318..854 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-19; cldn19
NM_001095417.1 - Xenopus laevis (African clawed frog) - NCBI
Sus scrofa claudin 18 (CLDN18), mRNA. (1318 bp)
NM_001160081.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus claudin 7 (Cldn7), mRNA. (1141 bp)
cld-7" /codon_start=1 /product="claudin-7 precursor" /protein_id="NP_113890.1" /db_xref="GeneID:65132" /db_xref="RGD:68432" /translation="MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALPAATQATRALMIVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMTGGIIFIVAGLAALVACSWIGHQIVTDFYNPLTPMNIKYEFGPAIFIGWAGSALVLLGGALLSCSCPGSESKAAYRAPRSYPKSNSSKEYV" sig_peptide 306..377 /gene="Cldn7" /gene_synonym="cld-7" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 315..818 /gene="Cldn7" /gene_synonym="cld-7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /...
Synonym: cld-7
NM_031702.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog (cldn5.S), mRNA. (1060 bp)
gene="cldn5.S" /gene_synonym="claudin-5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog" /protein_id="NP_001085820.1" /db_xref="GeneID:444247" /db_xref="Xenbase:XB-GENE-17332561" /translation="MASVGMEILGLSLSTLGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALSPELQAGRALTVLASMVGLIGLLVTVVGAKCTNCLHGSSVKGRVLLAGGIIYILCGILVLIPLCWIANIIITEFYDPRVPAPQKREMGAALYVGWAATSLLMLGGSLLCGSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 180..677 /gene="cldn5.S" /gene_synonym="claudin-5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-5
NM_001092351.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 7 (Cldn7), transcript variant 1, mRNA. (1311 bp)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_016887.6 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 18 (Cldn18), transcript variant A2.2, mRNA. (2786 bp)
Mus musculus claudin 18 (Cldn18), transcript variant A2.2, mRNA. ACCESSION NM_001194923 VERSION NM_001194923.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF349453.1, AA028634.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001194923.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA. (1995 bp)
synonym="claudin-19" /note="upstream in-frame stop codon" CDS 248..880 /gene="cldn19.L" /gene_synonym="claudin-19" /codon_start=1 /product="uncharacterized protein LOC494684" /protein_id="NP_001087995.1" /db_xref="GeneID:494684" /db_xref="Xenbase:XB-GENE-17346338" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV" misc_feature 257..793 /gene="cldn19.L" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family;...
Synonym: claudin-19
NM_001094526.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Sus scrofa claudin 1 (CLDN1), mRNA. (1237 bp)
gene="CLDN1" /gene_synonym="claudin1" /note="upstream in-frame stop codon" CDS 228..863 /gene="CLDN1" /gene_synonym="claudin1" /note="claudin-1 protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001231468.1" /db_xref="GeneID:100625166" /translation="MANAGLQLLGFILAFLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNTTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 240..746 /gene="CLDN1" /gene_synonym="claudin1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin1
NM_001244539.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 2 (CLDN2), mRNA. (954 bp)
CLDN2" /note="upstream in-frame stop codon" CDS 136..828 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="NP_001155110.1" /db_xref="GeneID:733684" /db_xref="VGNC:VGNC:86737" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTMLGLPADIQAAQAMMVTSSAISSLACIITVVGMRCTVFCQNSRAKDRVAVVGGVFFLLGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCPLQGNRSNYYDAYQAQPLATRSSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 202..678 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" ORIGIN // REFERENCE 1...
NM_001161638.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 14 (CLDN14), mRNA. (955 bp)
note="upstream in-frame stop codon" CDS 140..859 /gene="CLDN14" /codon_start=1 /product="claudin-14" /protein_id="NP_001155114.1" /db_xref="GeneID:100302017" /db_xref="VGNC:VGNC:86731" /translation="MASTAVQLLGFLLSFLGLVGTLLTTLLPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGVACACAVVGMKCTRCAKGTPAKATFAVLGGVLFLLAGLLCLVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPSRPYQAQPRAGTAAAPTAPAYRPPDAYKDNRAPSAISASYSGYRLNDYV" misc_feature <269..682 /gene="CLDN14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" ORIGIN // REFERENCE 1...
NM_001161642.1 - Sus scrofa (pig) - NCBI
Macaca mulatta claudin 24 (CLDN24), mRNA. (663 bp)
gene 1..663 /gene="CLDN24" /note="claudin 24" /db_xref="GeneID:100423881" /db_xref="VGNC:VGNC:71381" CDS 1..663 /gene="CLDN24" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001181809.1" /db_xref="GeneID:100423881" /db_xref="VGNC:VGNC:71381" /translation="MALIFRIVMQSVGLLLSFLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVTQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGEGQRDLKRRLLILGGVLSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHALLASGHYAVAQIQTQCSYLEDGTADPQV" misc_feature 37..516 /gene="CLDN24" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_001194880.2 - Macaca mulatta (Rhesus monkey) - NCBI

Data Export:


Debug Info:

Redirect URI :
lang : ja | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.089 | 0.089 | count_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.204 | 0.115 | search_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.210 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]