GGRNA ver.2 Help | Advanced search | English    旧バージョン

2021-10-29 01:43:29, GGRNA : RefSeq release 207 (Jul, 2021)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC003688.1, AJ011497.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185022.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1457 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185023.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (1542 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.6 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: Claudin-11; Claudin11; Osp; Ot; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 1 S homeolog (cldn1.S), mRNA. (1465 bp)
cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /note="Xclaudin 1" /codon_start=1 /product="claudin 1 S homeolog" /protein_id="NP_001079445.1" /db_xref="GeneID:379132" /db_xref="Xenbase:XB-GENE-951614" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKSFDSLLKLDSTIQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGDKIAKDFYNMFTPTNSKYEFGPALFIGWAGAALAIIGGALLCCSCPRKETSYPPPRGYNKSAPPAGKDYV" misc_feature 163..696 /gene="cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-1; cld1; cldn1; ilvasc; semp1
NM_001085976.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 19 S homeolog (cldn19.S), mRNA. (1944 bp)
"claudin-19; cldn19" /note="upstream in-frame stop codon" CDS 309..974 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /codon_start=1 /product="claudin 19 S homeolog" /protein_id="NP_001088886.1" /db_xref="GeneID:496231" /db_xref="Xenbase:XB-GENE-954660" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIAVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNDERRGQQYYRQSQPSATTREITKMPAKNKEETS" misc_feature 318..854 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-19; cldn19
NM_001095417.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 18 L homeolog (cldn18.L), mRNA. (2388 bp)
gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /codon_start=1 /product="claudin 18 L homeolog" /protein_id="NP_001083443.1" /db_xref="GeneID:398928" /db_xref="Xenbase:XB-GENE-991174" /translation="MSVTMCQTMGFLVSALGFAGIIAATALDPWSTQDLYDNPVTAVFQYQGLWKSCVQQSSGFTECRPYYTILGLPAMFQAVRALMIVGIVLGAIGLLVAIFSLKCIRIGNMEDSAKANITLTSGIMFILAGLCSIIGVSVFANMLITNFWMTTANMYTGGAISGMGGMGGLQTLQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLMPEESNYKAVSYHVSTKTPGYKTSAYEDKSKKSIYNESRRSEDGKSYPSKYDYV" misc_feature 102..677 /gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-18; cldn18
NM_001089974.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA. (1995 bp)
synonym="claudin-19" /note="upstream in-frame stop codon" CDS 248..880 /gene="cldn19.L" /gene_synonym="claudin-19" /codon_start=1 /product="uncharacterized protein LOC494684" /protein_id="NP_001087995.1" /db_xref="GeneID:494684" /db_xref="Xenbase:XB-GENE-17346338" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV" misc_feature 257..793 /gene="cldn19.L" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family;...
Synonym: claudin-19
NM_001094526.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 6, gene 2 L homeolog (cldn6.2.L), mRNA. (933 bp)
synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="claudin4L1" /codon_start=1 /product="claudin 6, gene 2 L homeolog" /protein_id="NP_001082332.1" /db_xref="GeneID:398409" /db_xref="Xenbase:XB-GENE-1009651" /translation="MASTGLQVLGMAMSIIGWVGCIITCAMPMWRVTAFIGNNIVVAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALTVICILVALLAMLVGIVGAKCTNCIEDENTKAKVSMVSGVVFLVAGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAAIYIGWASSALMLLGGGLLCCSCPKKNDAPYSARYTAPSGPARSDYPSKNYV" misc_feature 61..567 /gene="cldn6.2.L" /gene_synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA
NM_001088863.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 16 (Cldn16), mRNA. (1173 bp)
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: claudi; claudin-16; PC; PCLN1
NM_053241.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 1, mRNA. (2194 bp)
misc_feature 257..319 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 293..946 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_feature 368..370 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25
NM_171826.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 2, mRNA. (2187 bp)
product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature 286..939 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25
NM_001252450.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 3, mRNA. (2049 bp)
protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 3" /protein_id="NP_001239380.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <616..798 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25
NM_001252451.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 6, mRNA. (2209 bp)
misc_feature 272..334 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 308..961 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_feature 383..385 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25
NM_001356488.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Danio rerio claudin 7b (cldn7b), mRNA. (1950 bp)
cb388; claudin7; cld; cldn7; fd19f08; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 165..701 /gene="cldn7b" /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: cb388; claudin7; cld; cldn7; fd19f08; wu:fd19f08
NM_131637.1 - Danio rerio (zebrafish) - NCBI - UCSC
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 4, non-coding RNA. (2143 bp)
AI849195; AW489850; claudin-25; Cldn; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..734 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /inference="alignment:Splign:2.1.0" exon 735..2143 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2143) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25
NR_045517.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 5, non-coding RNA. (2005 bp)
AI849195; AW489850; claudin-25; Cldn; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..2005 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2005) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn; Cldn25
NR_045518.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Xenopus laevis claudin 1 S homeolog (cldn1.S), transcript variant X1, mRNA. (1522 bp)
LOCUS XM_041563893 1522 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 1 S homeolog (cldn1.S), transcript variant X1, mRNA. ACCESSION XM_041563893 VERSION XM_041563893.1 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-1; cld1; cldn1; ilvasc; semp1
XM_041563893.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Xenopus laevis claudin 18 L homeolog (cldn18.L), transcript variant X2, mRNA. (2529 bp)
LOCUS XM_041562121 2529 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 18 L homeolog (cldn18.L), transcript variant X2, mRNA. ACCESSION XM_041562121 VERSION XM_041562121.1 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-18; cldn18
XM_041562121.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Xenopus laevis claudin 18 L homeolog (cldn18.L), transcript variant X1, mRNA. (2563 bp)
LOCUS XM_041562120 2563 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 18 L homeolog (cldn18.L), transcript variant X1, mRNA. ACCESSION XM_041562120 VERSION XM_041562120.1 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-18; cldn18
XM_041562120.1 - Xenopus laevis (African clawed frog) - NCBI
Canis lupus familiaris claudin 2 (CLDN2), mRNA. (953 bp)
membrane protein claudin-2" /codon_start=1 /product="claudin-2" /protein_id="NP_001003089.1" /db_xref="GeneID:403649" /db_xref="VGNC:VGNC:39316" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 80..142 /gene="CLDN2" /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1); transmembrane region" misc_feature 125..601 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin...
NM_001003089.1 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Xenopus laevis claudin 19 L homeolog (cldn19.L), transcript variant X1, mRNA. (1055 bp)
LOCUS XM_018224573 1055 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 19 L homeolog (cldn19.L), transcript variant X1, mRNA. ACCESSION XM_018224573 VERSION XM_018224573.2 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-19
XM_018224573.2 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. (1035 bp)
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160098.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v2, mRNA. (1092 bp)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160097.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. (1143 bp)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160096.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a, mRNA. (1200 bp)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_023878.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 9 (Cldn9), mRNA. (1443 bp)
ulus claudin 9 (Cldn9), mRNA. ACCESSION NM_020293 VERSION NM_020293.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC154766.2. On Aug 6, 2010 this sequence version replaced NM_020293.2. Summary: This intronless gene encodes a member of the claudin family. Claudins...
Synonym: nmf32; nmf329
NM_020293.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. (852 bp)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160099.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 3 (Cldn3), mRNA. (1501 bp)
stop codon" CDS 441..1100 /gene="Cldn3" /note="RVP1; ventral prostate.1 protein" /codon_start=1 /product="claudin-3" /protein_id="NP_113888.2" /db_xref="GeneID:65130" /db_xref="RGD:68425" /translation="MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALLCCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV" misc_feature 447..941 /gene="Cldn3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" misc_feature 465..527 /gene="Cldn3" /note="...
NM_031700.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 7 (Cldn7), transcript variant 1, mRNA. (1311 bp)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_016887.6 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. (989 bp)
DEFINITION Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. ACCESSION NM_001193619 VERSION NM_001193619.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL596185.12. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
NM_001193619.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 1 (CLDN1), mRNA. (2578 bp)
note="claudin 1" /db_xref="CGNC:66478" /db_xref="GeneID:424910" exon 1..301 /gene="CLDN1" /inference="alignment:Splign:2.1.0" CDS 79..714 /gene="CLDN1" /note="tight junction protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001013629.1" /db_xref="CGNC:66478" /db_xref="GeneID:424910" /translation="MASGGLQLLGFVLAFLGWMGIIISTAMPQWKMASYAGDNIVTAQALYEGLWMSCAMQSTGQIQCKVYDSLLKLEGSLQATRALMVAAILLGLVGVFVAVTGMKCMKCMEDDQVKKMRMAVFGGVIFIIAGLSALVATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLALLGGAFLCCSCPRSETSYPPSRGYPKNAPSTGKDYV" misc_feature 91..624 /gene="CLDN1" /note="PMP-22/EMP/MP20/Claudin family;...
NM_001013611.2 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus claudin 17 (Cldn17), mRNA. (1172 bp)
musculus claudin 17 (Cldn17), mRNA. ACCESSION NM_181490 VERSION NM_181490.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK048287.1. On Apr 5, 2007 this sequence version replaced NM_181490.2. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_181490.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 5 (CLDN5), mRNA. (893 bp)
CLDN5" /note="claudin 5" /db_xref="GeneID:396997" /db_xref="VGNC:VGNC:107377" exon 1..893 /gene="CLDN5" /inference="alignment:Splign:2.1.0" CDS 101..757 /gene="CLDN5" /codon_start=1 /product="claudin-5" /protein_id="NP_001155108.1" /db_xref="GeneID:396997" /db_xref="VGNC:VGNC:107377" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVGAVLLALVALFVTLAGAQCTTCVAPGPGKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPMSQKYELGAALYIGWAASALLMCGGGLVCCGAWLCAGRPDLGFPVKYSAPRRPTATGDYDKKNYV" misc_feature 113..640 /gene="CLDN5" /note="PMP-22/EMP/MP20/Claudin family; Region...
NM_001161636.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus claudin 2 (Cldn2), mRNA. (3052 bp)
CDS 349..1041 /gene="Cldn2" /gene_synonym="RGD1560247" /codon_start=1 /product="claudin-2" /protein_id="NP_001100316.1" /db_xref="GeneID:300920" /db_xref="RGD:1560247" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV" misc_feature 361..891 /gene="Cldn2" /gene_synonym="RGD1560247" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" STS 349..1041 /gene="Cldn2" /...
Synonym: RGD1560247
NM_001106846.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 5 (Cldn5), mRNA. (1442 bp)
gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" exon 1..1427 /gene="Cldn5" /inference="alignment:Splign:2.1.0" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV" misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_031701.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 7 L homeolog (cldn7.L), mRNA. (1356 bp)
codon" CDS 140..781 /gene="cldn7.L" /gene_synonym="cldn7" /codon_start=1 /product="claudin 7 L homeolog" /protein_id="NP_001079709.1" /db_xref="GeneID:379396" /db_xref="Xenbase:XB-GENE-6078955" /translation="MANSGLQLLGFVLAMLGWIALIAATIMPQWKMSSYAGDQIITAVAIYQGLWMSCATQSTGQIQCKVYDSILQLDASLQATRALMVVSIILGIFGIAVSTMGMKCTTCGGDDKVKKSRIAMTGGFVFLLGGLAALIACSWYGNQIIRDFYNPLLPINTKYEFGAGVFLGWAGSFLVLIGGGLLSCSCSRKNNYQKGYPKSGAKSKVPSSGRDYV" misc_feature 149..685 /gene="cldn7.L" /gene_synonym="cldn7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /db_xref="CDD:250157" misc_feature...
Synonym: cldn7
NM_001086240.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant b, mRNA. (960 bp)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_021386.3. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_021386.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 1 (Cldn1), mRNA. (3223 bp)
gene="Cldn1" /note="claudin 1" /db_xref="GeneID:65129" /db_xref="RGD:68422" exon 1..402 /gene="Cldn1" /inference="alignment:Splign:2.1.0" CDS 180..815 /gene="Cldn1" /codon_start=1 /product="claudin-1" /protein_id="NP_113887.3" /db_xref="GeneID:65129" /db_xref="RGD:68422" /translation="MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFVISGLATLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV" misc_feature 192..725 /gene="Cldn1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_031699.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 3, mRNA. (3752 bp)
DEFINITION Mus musculus claudin 12 (Cldn12), transcript variant 3, mRNA. ACCESSION NM_001193660 VERSION NM_001193660.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY012969.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane...
NM_001193660.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 4, mRNA. (3639 bp)
musculus claudin 12 (Cldn12), transcript variant 4, mRNA. ACCESSION NM_001193661 VERSION NM_001193661.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY018558.1, AK166110.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001193661.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 9 (Cldn9), mRNA. (1432 bp)
gene="Cldn9" /note="upstream in-frame stop codon" CDS 364..1017 /gene="Cldn9" /codon_start=1 /product="claudin-9" /protein_id="NP_001011889.1" /db_xref="GeneID:287099" /db_xref="RGD:1308999" /translation="MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 373..852 /gene="Cldn9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN // REFERENCE 1 (bases 1 to 1432) AUTHORS...
NM_001011889.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 2, mRNA. (3804 bp)
musculus claudin 12 (Cldn12), transcript variant 2, mRNA. ACCESSION NM_001193659 VERSION NM_001193659.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB845860.1, AK039672.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001193659.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Pan troglodytes claudin 11 (CLDN11), transcript variant X1, mRNA. (1857 bp)
LOCUS XM_009446623 1857 bp mRNA linear PRI 20-MAR-2018 DEFINITION PREDICTED: Pan troglodytes claudin 11 (CLDN11), transcript variant X1, mRNA. ACCESSION XM_009446623 VERSION XM_009446623.3 DBLINK BioProject: PRJNA10627 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_036882.1)...
Synonym: claudin-11
XM_009446623.3 - Pan troglodytes (chimpanzee) - NCBI
Mus musculus claudin 12 (Cldn12), transcript variant 1, mRNA. (3794 bp)
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY138805.1, AK128999.1 and AC068663.5. On Aug 14, 2009 this sequence version replaced NM_022890.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
NM_022890.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin-8-like (LOC108277897), mRNA. (2895 bp)
Data-START## Transcript is intronless :: KM870785.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..2895 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..2895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="claudin-8-like" /db_xref="GeneID:108277897" exon 1..2895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /inference="alignment:Splign:2.1.0" misc_feature 893..895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="upstream in-frame stop codon" CDS...
Synonym: Claudin-8; CLDN8; CLDN8c
NM_001329287.1 - Ictalurus punctatus (channel catfish) - NCBI
Mus musculus claudin 18 (Cldn18), transcript variant A2.1, mRNA. (2774 bp)
Mus musculus claudin 18 (Cldn18), transcript variant A2.1, mRNA. ACCESSION NM_001194921 VERSION NM_001194921.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK033657.1, AF349451.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001194921.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 18 (Cldn18), transcript variant A2.2, mRNA. (2786 bp)
Mus musculus claudin 18 (Cldn18), transcript variant A2.2, mRNA. ACCESSION NM_001194923 VERSION NM_001194923.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF349453.1, AA028634.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001194923.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/claudin
lang : ja | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.104 | 0.104 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.243 | 0.139 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.249 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]