GGRNA ver.2 Help | Advanced search | English    旧バージョン

2017-10-21 02:45:51, GGRNA : RefSeq release 84 (Sep, 2017)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
us claudin 11 (Cldn11), mRNA. ACCESSION NM_008770 VERSION NM_008770.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: Claudin-11; Claudin11; Osp; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 1 (CLDN1), mRNA. (1237 bp)
gene="CLDN1" /gene_synonym="claudin1" /note="upstream in-frame stop codon" CDS 228..863 /gene="CLDN1" /gene_synonym="claudin1" /note="claudin-1 protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001231468.1" /db_xref="GeneID:100625166" /translation="MANAGLQLLGFILAFLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNTTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 240..746 /gene="CLDN1" /gene_synonym="claudin1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin1
NM_001244539.1 - Sus scrofa (pig) - NCBI
Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1944 bp)
DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. ACCESSION NM_001185023 VERSION NM_001185023.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (2029 bp)
ns claudin 7 (CLDN7), transcript variant 1, mRNA. ACCESSION NM_001307 VERSION NM_001307.5 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On May 29, 2010 this sequence version replaced NM_001307.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
SEP-2017 DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. ACCESSION NM_001185022 VERSION NM_001185022.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ011497.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Danio rerio claudin 7b (cldn7b), mRNA. (1950 bp)
gene_synonym="cb388; claudin7; cldn7; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7; fd19f08" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 165..701 /gene="cldn7b" /gene_synonym="cb388; claudin7; cldn7; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: cb388; claudin7; cldn7; wu:fd19f08
NM_131637.1 - Danio rerio (zebrafish) - NCBI - UCSC
Sus scrofa claudin 1-like (LOC396566), mRNA. (1012 bp)
replace="a" /replace="t" /db_xref="dbSNP:81402566" CDS 175..810 /gene="LOC396566" /codon_start=1 /product="claudin-1-like" /protein_id="NP_001155107.1" /db_xref="GeneID:396566" /translation="MANAGLQLLGFILAFLGWIGSIVSTALLQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATARYGNRIVQEFYHLMTPVNARYEFGQALFTGWAAASLCLLGGALLCRSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 187..693 /gene="LOC396566" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1 (bases 1 to 1012) AUTHORS Martin-Martin,N...
NM_001161635.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 6 (CLDN6), mRNA. (746 bp)
chromosome="3" /map="3" gene 1..746 /gene="CLDN6" /note="claudin 6" /db_xref="GeneID:100302020" CDS 19..684 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="NP_001155117.1" /db_xref="GeneID:100302020" /translation="MASAGLQILGIVLTLFGWVNALVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLSGAKCTTCVEDKDTKARLVLTSGIIFVLSGVLTLIPVCWTAHAIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGRSQGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 31..528 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement...
NM_001161645.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus claudin 5 (Cldn5), mRNA. (1442 bp)
map="11q23" gene 1..1442 /gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV" misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
NM_031701.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin-14-like (LOC108261078), mRNA. (2836 bp)
gene="LOC108261078" /gene_synonym="CLDN14a" /note="claudin 14a" /codon_start=1 /product="claudin-14-like" /protein_id="NP_001316186.1" /db_xref="GeneID:108261078" /translation="MGIMAQQFLGFFLGLLGLVGTLTSTVLPHWRQTAYFSTNFLTASYYMKGLWMECVSHTAGIYQCEFHRSMLSLPKDLLAARILMVLSSTTSILAAIVSAVGMKCTRCVQQSHAKGSIAVSGGSCFVLAGLFCLITTSWTTCDVIKDAYDLFSTVGMKYEIGLAVYISFSSAIFSICGGGMLCVASWDVRNYVSHKVADPQVPSPNKLQHPAACQANAAFESDHSSSPTFSLISEYRLSDSISESSIKSKT" misc_feature 1964..2452 /gene="LOC108261078" /gene_synonym="CLDN14a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN...
Synonym: CLDN14a
NM_001329257.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-like protein ZF-A9 (LOC108258891), mRNA. (1479 bp)
stop codon" CDS 226..855 /gene="LOC108258891" /gene_synonym="CLDN32c" /note="claudin 32c" /codon_start=1 /product="claudin-like protein ZF-A9" /protein_id="NP_001316180.1" /db_xref="GeneID:108258891" /translation="MSAGLQMLGTALGVVGWLGTILACALPLWRVTAFIGNNIVTAQVVSEGLWMTCVTQSTGQMQCKVYDSMLALSSDLQTSRAILVITLLVMLVAILASIAGGECTNCLAQGTAKARVATAAGVFFLLAGILSLVPPSWIANTVIKDFYDPLVAQSQKRELGASIFICWGAAVLMVIGGGLLCTSWPSGRGCQMGHYKPASQTSRERAAYV" misc_feature 235..765 /gene="LOC108258891" /gene_synonym="CLDN32c" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN32c
NM_001329251.1 - Ictalurus punctatus (channel catfish) - NCBI
Sus scrofa claudin 7 (CLDN7), mRNA. (986 bp)
CDS 173..808 /gene="CLDN7" /codon_start=1 /product="claudin-7 precursor" /protein_id="NP_001153548.1" /db_xref="GeneID:100127486" /translation="MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKTYDSVLALSAALQATRALMVVSLVLGLMAMFVGTMGMKCTNCGGDDKVKKARIAMTGGIIFIVAGLCALIACSWYGHQIVTDFYNPLVPTNVKYEFGPAIFIGWAGSSLVLLGGALLSCSCPGSEGQSGYRAPRSYPKPNSAKEYV" sig_peptide 173..244 /gene="CLDN7" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 182..718 /gene="CLDN7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /db_xref="CDD:250157" STS 511..814 /gene...
NM_001160076.1 - Sus scrofa (pig) - NCBI
Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. (1517 bp)
LOCUS NM_001141277 1517 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. ACCESSION NM_001141277 VERSION NM_001141277.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT048904.1. ##Evidence-Data-START## Transcript...
NM_001141277.1 - Salmo salar (Atlantic salmon) - NCBI
Danio rerio claudin 19 (cldn19), mRNA. (1461 bp)
codon" CDS 104..733 /gene="cldn19" /gene_synonym="zgc:112141" /codon_start=1 /product="claudin-19" /protein_id="NP_001017736.1" /db_xref="GeneID:550431" /db_xref="ZFIN:ZDB-GENE-050417-242" /translation="MANSGFQLLGYFLALGGWIGIISTTVLPQWKQSSYAGDAIIMAVGLYEGLWMSCASQSTGQVQCKIFDSLLSLDVNIQTCRALMVISVLMGFMGIIVSVVGMKCTKVGDNNPSTKSKIAISGGSLFLLSGVCTLVAVSWYAAQVSAHFFDPNTPTNAKYDFGTALFVGWAASVLMMLGGAFLCCSCINEDRRGQQFYRQSQPSTTREYV" misc_feature 113..649 /gene="cldn19" /gene_synonym="zgc:112141" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1...
Synonym: zgc:112141
NM_001017736.1 - Danio rerio (zebrafish) - NCBI - UCSC
Oryctolagus cuniculus claudin 12 (CLDN12), mRNA. (735 bp)
LOCUS NM_001171276 735 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus claudin 12 (CLDN12), mRNA. ACCESSION NM_001171276 VERSION NM_001171276.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000945.1. FEATURES Location/...
NM_001171276.1 - Oryctolagus cuniculus (rabbit) - NCBI
Salmo salar Claudin-14 (cld14), mRNA. (1872 bp)
LOCUS NM_001140323 1872 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-14 (cld14), mRNA. ACCESSION NM_001140323 VERSION NM_001140323.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT045650.1. ##Evidence-Data-START## Transcript exon combination...
NM_001140323.1 - Salmo salar (Atlantic salmon) - NCBI
Ictalurus punctatus claudin 2 (cldn2), mRNA. (1240 bp)
e="claudin 2" /db_xref="GeneID:108279352" misc_feature 264..266 /gene="cldn2" /note="upstream in-frame stop codon" CDS 276..1118 /gene="cldn2" /codon_start=1 /product="claudin-2" /protein_id="NP_001316237.1" /db_xref="GeneID:108279352" /translation="MAIAAVELMGFFLGILGMIGNLVATLLPYWEVSAHIGQNIVTAVTNMKGLWMACVHQSTGVFQCETFSTSLGLSTELQAARAMMVFSVIFSALACAVSSVGMQCTTCMDGFSGAKAKAAGAGGCLFFIAGLLSLIPISWQTHEVVQTFYQYTEHDGLKFEIGDCLFVGFASSIVSLLGGGLLSMSCCSYKDVQRRFRHHAGGYPYPERVGKHGTGRSASGWTPFRPSATLQSGINMNPTNRTQTMDSHYSSSSQSTTGVQDSTKPAHRKPAASYEVTGYV" misc_feature 288..821 /gene="cldn2" /note="PMP-22/EMP/MP20/Claudin...
NM_001329308.1 - Ictalurus punctatus (channel catfish) - NCBI
Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. (989 bp)
DEFINITION Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. ACCESSION NM_001193619 VERSION NM_001193619.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL596185.12. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
NM_001193619.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 7 (Cldn7), transcript variant 1, mRNA. (1311 bp)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_016887.6 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Papio anubis claudin 12 (CLDN12), mRNA. (735 bp)
LOCUS NM_001168990 735 bp mRNA linear PRI 11-SEP-2012 DEFINITION Papio anubis claudin 12 (CLDN12), mRNA. ACCESSION NM_001168990 VERSION NM_001168990.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Papio. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000509.1. FEATURES...
NM_001168990.1 - Papio anubis (olive baboon) - NCBI
Danio rerio claudin 15-like b (cldn15lb), mRNA. (1530 bp)
="claudin 15-like b precursor" /protein_id="NP_001002446.2" /db_xref="GeneID:436719" /db_xref="ZFIN:ZDB-GENE-040718-145" /translation="MAVMVLQVLGLFLGIVGWCLESSSINSSVWKSSSHGEAVVTASSQFEGLWFSCASNSLGAIHCQRFKTTLGLPGYIQACRALMIIALILGLLSVVLASMGLKCTKLGSTSEEAKGKISLTAGIMFILSGLCVIVAVSWYAARVVQEFNDPFYGGTKYELGAGLYLGWAAAALCILGGGTLCTSFKGSSPAQTRGPGYNYSAAQPQKIYRSAPSDNSITKAYV" sig_peptide 127..183 /gene="cldn15lb" /gene_synonym="cldn10l1b; zgc:92349" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 136..657 /gene="cldn15lb" /gene_synonym="cldn10l1b; zgc:92349" /note="PMP-22/EMP/MP20/Claudin...
Synonym: cldn10l1b; zgc:92349
NM_001002446.2 - Danio rerio (zebrafish) - NCBI - UCSC
Oncorhynchus mykiss claudin 30 (LOC100642186), mRNA. (627 bp)
chromosome="24" /map="24" gene 1..627 /gene="LOC100642186" /note="claudin 30" /db_xref="GeneID:100642186" CDS 1..627 /gene="LOC100642186" /codon_start=1 /product="claudin 30" /protein_id="NP_001233202.1" /db_xref="GeneID:100642186" /translation="MASAGFQMLGTALGIIGWIGAIVVCALPQWKVTAFIGENIITAQTTWQGIWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALIIISIMMGLVGILLSVAGGKCTNCVEDERAKSRIGVGSGVVFIIAGILCLIPVCWSANTIIRDFYNPMLMSSQKMELGAALYIGWGAAALMIMGGGFLCANCPPKEDNYPTKYSAARSTAPKDYV" misc_feature 13..543 /gene="LOC100642186" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN...
NM_001246273.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
PREDICTED: Canis lupus familiaris claudin 2 (CLDN2), transcript variant X1, mRNA. (1704 bp)
CDS 375..1343 /gene="CLDN2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_013966788.1" /db_xref="GeneID:403649" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGSESTPARDTFLGQNSSRFFPKVKIPWRPWVDFGSSDSIDRGQRKSRFEKVEKKGGVMALCPSSRSAKNLRRNRTMINQDLLLEKILFQGDCNLS" misc_feature 441..917 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
XM_014111313.2 - Canis lupus familiaris (dog) - NCBI
Salmo salar Claudin-5 (cld5), mRNA. (1344 bp)
LOCUS NM_001146383 1344 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-5 (cld5), mRNA. ACCESSION NM_001146383 VERSION NM_001146383.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT056482.1. ##Evidence-Data-START## Transcript exon combination ::...
NM_001146383.1 - Salmo salar (Atlantic salmon) - NCBI
Ictalurus punctatus claudin 15 (cldn15), mRNA. (1474 bp)
Data-START## Transcript exon combination :: KM870792.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1474 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="7" /map="7" gene 1..1474 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="claudin 15" /db_xref="GeneID:108267636" misc_feature 222..224 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="upstream in-frame stop codon" CDS 282..953 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="claudin 15a" /codon_start=1 /product="claudin 15" /protein_id="NP...
Synonym: Claudin-15; CLDN15a
NM_001329306.1 - Ictalurus punctatus (channel catfish) - NCBI
PREDICTED: Canis lupus familiaris claudin 17 (CLDN17), mRNA. (1511 bp)
feature by RNAseq alignments" /db_xref="GeneID:487720" CDS 444..1118 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_544844.1" /db_xref="GeneID:487720" /translation="MAFYPLQIAGLVLGFFGLVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCVRQAKIRLQCKFYSSLLALPPALEAARALMCVAVALSFIALLIGICGMKQIQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVCWTANIIIRDFYNPAIHVGQKRELGAALFLGWASTAVLFIGGGLLCGFCCCNRKKQRHRYPAPGYCVPHTENRRNVTVLNKTSTSYV" misc_feature 459..989 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_544844.3 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Canis lupus familiaris claudin 9 (CLDN9), mRNA. (2055 bp)
genomic feature by RNAseq alignments" /db_xref="GeneID:490049" CDS 887..1540 /gene="CLDN9" /codon_start=1 /product="claudin-9" /protein_id="XP_005621712.1" /db_xref="GeneID:490049" /translation="MASTALELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGLLVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPPQMDRPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 896..1339 /gene="CLDN9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_005621655.3 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Canis lupus familiaris claudin 25 (CLDN25), mRNA. (1193 bp)
by RNAseq alignments" /db_xref="GeneID:489401" CDS 104..790 /gene="CLDN25" /codon_start=1 /product="putative claudin-25" /protein_id="XP_546519.1" /db_xref="GeneID:489401" /translation="MAWSFREKAQLGGLLLSLLGWVCSCVTTILPQWKTLNLELNEMETWIMGLWEVCVNQEEVVVCKAFESFLSLPQDLQVSRILMVASHGLGLLGLLLSGFGSECFQLYRNRWVFKRWLCLLGGTLEASASATTLFPVSWVAYATIQDFWDDSIPEIVPRWEFGDALYLGWAAGIFLALGGLFLIFSACLGKEEESSLRMAGPTVPPFYAPADRSSDSFYLTPRPRNLFI" misc_feature 179..649 /gene="CLDN25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_546519.2 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Canis lupus familiaris claudin 7 (CLDN7), mRNA. (861 bp)
with support for all annotated introns" /db_xref="GeneID:489466" CDS 1..636 /gene="CLDN7" /codon_start=1 /product="claudin-7" /protein_id="XP_546584.3" /db_xref="GeneID:489466" /translation="MANSGLQLLGFALALVGWAGLVASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTNCGGDDKVKKARIAMTGGIIFIVGGLAALVACSWYGHQIVTDFYNPLVPMNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGSESKAGYRAPRSYPKPNSAKEYV" misc_feature 10..546 /gene="CLDN7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /db_xref="CDD:250157" ORIGIN //...
XM_546584.5 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Canis lupus familiaris claudin 1 (CLDN1), mRNA. (3209 bp)
with support for all annotated introns" /db_xref="GeneID:608207" CDS 69..704 /gene="CLDN1" /codon_start=1 /product="claudin-1" /protein_id="XP_850248.1" /db_xref="GeneID:608207" /translation="MANAGLQLLGFLLAFLGWVGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATIGMKCMKCMEDDEVQKMRMAVIGGVIFLIAGLAVLVATAWYGNRIVQDFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV" misc_feature 120..587 /gene="CLDN1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_845155.5 - Canis lupus familiaris (dog) - NCBI
Ictalurus punctatus claudin-8-like (LOC108277897), mRNA. (2895 bp)
Data-START## Transcript is intronless :: KM870785.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..2895 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..2895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="claudin-8-like" /db_xref="GeneID:108277897" misc_feature 893..895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="upstream in-frame stop codon" CDS 911..1951 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="claudin 8c" /codon_start=1 /product="...
Synonym: Claudin-8; CLDN8; CLDN8c
NM_001329287.1 - Ictalurus punctatus (channel catfish) - NCBI
PREDICTED: Canis lupus familiaris claudin 8 (CLDN8), mRNA. (2269 bp)
feature by RNAseq alignments" /db_xref="GeneID:478401" CDS 332..1009 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="XP_005638865.1" /db_xref="GeneID:478401" /translation="MATYALQIAGLVLGGFGMVGTLAVTIMPQWRVSAFIGSNIVVFENFWEGLWMNCVRQANIRMQCKVYDSLLALSPDLQASRGLMCAASVLSFLAFMTAVLGMKCTRCTGDDEKIKGHILLTAGIIFIVTGILVLIPVSWVANSIIREFYNPIVETAQKHELGDALYIGWTTALVLIAGGALFCCVSCYSEKSRSYRYSIPSHRTAQKSYHMEKKSPSVYSRSQYV" misc_feature 344..877 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_005638808.3 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Canis lupus familiaris claudin 11 (CLDN11), mRNA. (1750 bp)
with support for all annotated introns" /db_xref="GeneID:488160" CDS 122..745 /gene="CLDN11" /codon_start=1 /product="claudin-11" /protein_id="XP_545284.3" /db_xref="GeneID:488160" /translation="MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVMLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVIVCCAGDAQAFGENRFYYSSGSSSPTHAKSAHV" misc_feature 137..637 /gene="CLDN11" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_545284.6 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Canis lupus familiaris claudin 15 (CLDN15), transcript variant X1, mRNA. (1820 bp)
samples with support for all annotated introns" /db_xref="GeneID:608226" CDS 579..1082 /gene="CLDN15" /codon_start=1 /product="claudin-15 isoform X1" /protein_id="XP_005621060.1" /db_xref="GeneID:608226" /translation="MSVAVETFGFFMAALGLLMLGVTLPNSYWRVSTVHGSVITTNTIFENLWFSCATDSLGVYSCREFPSLLALSGYLQACRALMITAIFLGFLGLFLGMVGLRCINIGGMELSRKAKLAATAGVLHILAGNWGKVVGVPCVVCVWGGGGFPGFPVLSSLPLPVRVSPSP" misc_feature 588..>899 /gene="CLDN15" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_005621003.3 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Canis lupus familiaris claudin 20 (CLDN20), mRNA. (4218 bp)
for all annotated introns" /db_xref="GeneID:608935" CDS 1431..2090 /gene="CLDN20" /codon_start=1 /product="claudin-20" /protein_id="XP_005615593.1" /db_xref="GeneID:608935" /translation="MASAGLQLLAFVLALSGVSGVLTATLLPNWKVNVDSGSNIITAIVQLQGLWMDCTWYSTGMFSCTLKFSILSLPIYVQAARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFAGGVCLMSAGISGLIPTVWYTKEIIADFLDLTVPESNKHEPGGAVYIGFISAILLFVSGMIFCTSCIEKNPEAWLYPPKQQHIPATQLEGNSAYNLKDYV" misc_feature 1443..1973 /gene="CLDN20" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_005615536.3 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Canis lupus familiaris claudin 6 (CLDN6), transcript variant X1, mRNA. (1389 bp)
with support for all annotated introns" /db_xref="GeneID:490048" CDS 170..835 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="XP_547168.3" /db_xref="GeneID:490048" /translation="MASAGLQILGIILTLLGWVNALVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVYLAGAKCTTCVEDKDSKARLVLVSGIIFVISGVLTLIPVCWTAHAIIRDFYNPLVSDAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGGRSSSHYMARYSASAAHATSPCAPEYPTKNYV" misc_feature 182..679 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_547168.4 - Canis lupus familiaris (dog) - NCBI
Ictalurus punctatus claudin 1 (cldn1), mRNA. (1765 bp)
single sample supports all introns SAMN00774075 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1765 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..1765 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="claudin 1" /db_xref="GeneID:108278410" misc_feature 810..812 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="upstream in-frame stop codon" CDS 882..1547 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="claudin 26" /codon_start=1 /product="claudin 1 precursor" /...
Synonym: Claudin-10; CLDN10; CLDN26
NM_001329305.1 - Ictalurus punctatus (channel catfish) - NCBI
PREDICTED: Papio anubis claudin 6 (CLDN6), mRNA. (1826 bp)
alignments" /db_xref="GeneID:101014992" CDS 425..1198 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="XP_021787371.1" /db_xref="GeneID:101014992" /translation="MVYAPSVLSTCGLRSGPARPHLAVLLSQIQCSSFNLAMASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGVSRGPSHYMARYSTSAPVISRGPSEYPTKNYV" misc_feature 548..1045 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" ORIGIN //...
XM_021931679.1 - Papio anubis (olive baboon) - NCBI
PREDICTED: Canis lupus familiaris claudin 24 (CLDN24), transcript variant X1, mRNA. (967 bp)
for all annotated introns" /db_xref="GeneID:482918" CDS 1..663 /gene="CLDN24" /codon_start=1 /product="putative claudin-24" /protein_id="XP_540033.2" /db_xref="GeneID:482918" /translation="MALVFRVAMQFAGLFLSLLGWVLAIITTYLPHWKNLNLDLNEMENWTVGLWQACVTQEEVGTQCKDFDSFLALPAELRVSRVLMLLSNGLGLLGLLAAGLGLDCLRLGESRRGLKKGLLILGGTVLWAAGVAALVPVSWVAHRTVREFWDETVPEIVPRWEFGEALFLGWFAGFFLLLGGGLLNCAACSTRAARASGHYAGAETRTRCPYLENGTADPRV" misc_feature 28..516 /gene="CLDN24" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_540033.5 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Papio anubis claudin 4 (CLDN4), mRNA. (4115 bp)
feature by RNAseq alignments" /db_xref="GeneID:101014597" CDS 2635..3264 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="XP_003895932.1" /db_xref="GeneID:101014597" /translation="MASMGLQVTGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLLVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV" misc_feature 2644..3144 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_003895883.3 - Papio anubis (olive baboon) - NCBI
Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA. (2908 bp)
ynonym="claudin-3; cldn3" /note="upstream in-frame stop codon" CDS 376..1017 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /codon_start=1 /product="claudin 3 L homeolog" /protein_id="NP_001087400.1" /db_xref="GeneID:447224" /db_xref="Xenbase:XB-GENE-6078310" /translation="MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV" misc_feature 382..915 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /note="PMP-22/EMP/MP20/Claudin family...
Synonym: claudin-3; cldn3
NM_001093931.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Canis lupus familiaris claudin 4 (CLDN4), mRNA. (3480 bp)
support for all annotated introns" /db_xref="GeneID:100856416" CDS 2041..2673 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="XP_005621019.1" /db_xref="GeneID:100856416" /translation="MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALMVVSIILAALGVLLSVVGGKCTNCVEDESAKAKTMIVAGVVFLLAGLLVMVPASWTANNIIRDFYNPLVVSGQKREMGASLYVGWAASGLLLLGGALLCCNCPPRADKPYSAKYSAAARSAPASNYV" misc_feature 2050..2544 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_005620962.3 - Canis lupus familiaris (dog) - NCBI
PREDICTED: Papio anubis claudin 3 (CLDN3), mRNA. (1605 bp)
feature by RNAseq alignments" /db_xref="GeneID:101014245" CDS 559..1221 /gene="CLDN3" /codon_start=1 /product="claudin-3" /protein_id="XP_003895931.1" /db_xref="GeneID:101014245" /translation="MSMGLEITGTALAVLGWLGTIVCCALPMWRVTAFIGSNIITSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSANTIIREFYNPVVPEAQKREMGTSLYVGWAAAALQLLGGALLCCSCPPREKKYMPTKVVYSAPRSTGPGASMGTAYDRKDYV" misc_feature 565..1059 /gene="CLDN3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_003895882.4 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis claudin 9 (CLDN9), mRNA. (2888 bp)
feature by RNAseq alignments" /db_xref="GeneID:101014276" CDS 1747..2400 /gene="CLDN9" /codon_start=1 /product="claudin-9" /protein_id="XP_003916467.1" /db_xref="GeneID:101014276" /translation="MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLLAITGAQCTTCVEDEGAKARIMLTAGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPLPQVERPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 1756..2199 /gene="CLDN9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_003916418.3 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis claudin 17 (CLDN17), mRNA. (4367 bp)
by RNAseq alignments" /db_xref="GeneID:101020994" CDS 2016..2690 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_003895607.1" /db_xref="GeneID:101020994" /translation="MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARARLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCMGSNERTKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAVHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNMKMPSNTSTSYV" misc_feature 2031..2561 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_003895558.4 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis claudin 8 (CLDN8), mRNA. (2653 bp)
feature by RNAseq alignments" /db_xref="GeneID:101020651" CDS 718..1395 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="XP_003895606.1" /db_xref="GeneID:101020651" /translation="MAIHALEIAGLFLGGVGMVGTVAVTIMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWVANAIIRDFYNPIVNVAQKRELGEALYLGWTTALVLIVGGALFCCIFCCNEKSSSYRYSIPSHRTTQRSYHMEKKSPSVYSRSQYV" misc_feature 730..1263 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_003895557.3 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis claudin 2 (CLDN2), mRNA. (3816 bp)
by RNAseq alignments" /db_xref="GeneID:101015375" CDS 1139..1831 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="XP_009196326.1" /db_xref="GeneID:101015375" /translation="MASLGLQIVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMKCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQLPKVKSEFNSYSLTGYV" misc_feature 1151..1681 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_009198062.3 - Papio anubis (olive baboon) - NCBI
PREDICTED: Canis lupus familiaris claudin 5 (CLDN5), mRNA. (2487 bp)
db_xref="GeneID:100684266" CDS 1022..1876 /gene="CLDN5" /codon_start=1 /product="claudin-5" /protein_id="XP_005636646.1" /db_xref="GeneID:100684266" /translation="MGSPPRGARRSEAVPDPPGPRTGGGEPSARAQRHQGPLRAPSRSTEAPPRPAPRPGGRRAPVSPPAMGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVGAVLLALVALFVTLAGAQCTTCVAPGPAKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPMSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCAGRPDFSFPVKYSAPRRPTATGDYDKKNYV" misc_feature 1232..1759 /gene="CLDN5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_005636589.3 - Canis lupus familiaris (dog) - NCBI
Xenopus tropicalis claudin 8, gene 2 (cldn8.2), mRNA. (2062 bp)
XB-GENE-991592" CDS 31..711 /gene="cldn8.2" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.2" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Canis lupus familiaris claudin 14 (CLDN14), transcript variant X1, mRNA. (1270 bp)
for all annotated introns" /db_xref="GeneID:487751" CDS 234..947 /gene="CLDN14" /codon_start=1 /product="claudin-14" /protein_id="XP_013965166.1" /db_xref="GeneID:487751" /translation="MASTAVQLLGFLLSFLGLVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSAAACACAVVGMKCTRCAKGTPAKTVCAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFELGQALYLGFISSSLSLIGGTLLCLSCLDEVPSGPHQVPPRATTATTAPAYRPPAAFKDNRAPSATSASLSGYRLNDYV" misc_feature 300..776 /gene="CLDN14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_014109691.2 - Canis lupus familiaris (dog) - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/claudin
lang : ja | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.128 | 0.128 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.271 | 0.142 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.276 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]