GGRNA ver.2 Help | Advanced search | English    旧バージョン

2024-04-25 15:59:53, GGRNA : RefSeq release 222 (Jan, 2024)




Homo sapiens claudin 2 (CLDN2), transcript variant 2, mRNA. (3163 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF177340.1, AK075405.1 and AA973123.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region...
Synonym: claudin-2; OAZON
NM_001171092.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 3, mRNA. (2921 bp)
This record has been curated by NCBI staff. The reference sequence was derived from AK312515.1, AK075405.1 and AA973123.1. On Aug 13, 2020 this sequence version replaced NM_001171095.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5'...
Synonym: claudin-2; OAZON
NM_001171095.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 1, mRNA. (2961 bp)
was derived from DA743944.1, AK075405.1 and AA973123.1. This sequence is a reference standard in the RefSeqGene project. On Jun 2, 2019 this sequence version replaced NM_020384.3. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated...
Synonym: claudin-2; OAZON
NM_020384.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1457 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185023.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC003688.1, AJ011497.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185022.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (1542 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.6 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Canis lupus familiaris claudin 3 (CLDN3), mRNA. (1006 bp)
AF358908.1, SRR10915302.2005862.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1006 /organism="Canis lupus familiaris" /mol_type="mRNA" /sub_species="familiaris" /db_xref="taxon:9615" /chromosome="6" /map="6" gene 1..1006 /gene="CLDN3" /gene_synonym="Claudin-3" /note="claudin 3" /db_xref="GeneID:403648" /db_xref="VGNC:VGNC:39319" exon 1..1006 /gene="CLDN3" /gene_synonym="Claudin-3" /inference="alignment:Splign:2.1.0" misc_feature 56..58 /gene="CLDN3" /gene_synonym="Claudin-3" /note="upstream in-frame stop codon" CDS 209..865 /gene="CLDN3" /gene_synonym="Claudin...
Synonym: Claudin-3
NM_001003088.1 - Canis lupus familiaris (dog) - NCBI
Pan troglodytes claudin 11 (CLDN11), mRNA. (2174 bp)
="claudin-11" /note="upstream in-frame stop codon" CDS 200..823 /gene="CLDN11" /gene_synonym="claudin-11" /note="claudin 11 (oligodendrocyte transmembrane protein)" /codon_start=1 /product="claudin-11" /protein_id="NP_001233342.1" /db_xref="GeneID:460846" /db_xref="VGNC:VGNC:1780" /translation="MVATFLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV" misc_feature 215..715 /gene="CLDN11" /gene_synonym="claudin-11" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-11
NM_001246413.1 - Pan troglodytes (chimpanzee) - NCBI
Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: Claudin-11; Claudin11; Osp; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Macaca mulatta claudin 22 (CLDN22), mRNA. (1630 bp)
gene="CLDN22" /gene_synonym="claudin-22" /note="upstream in-frame stop codon" CDS 558..1217 /gene="CLDN22" /gene_synonym="claudin-22" /codon_start=1 /product="claudin-22" /protein_id="NP_001252773.1" /db_xref="GeneID:701348" /translation="MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVTQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGEGQRDLKRRLLILGGVLSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHALLASGHHAVAQMQDHHQLETRNTNLKN" misc_feature 585..1073 /gene="CLDN22" /gene_synonym="claudin-22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-22
NM_001265844.1 - Macaca mulatta (Rhesus monkey) - NCBI
PREDICTED: Gallus gallus claudin 10 (CLDN10), transcript variant X1, mRNA. (843 bp)
CGNC:13756" /db_xref="GeneID:418790" CDS 16..582 /gene="CLDN10" /gene_synonym="claudin-10" /codon_start=1 /product="claudin-10 isoform X1" /protein_id="XP_046764109.1" /db_xref="GeneID:418790" /db_xref="CGNC:13756" /translation="MLISLELWQNEALLLELDFGQRFLKYVCNAAERGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" misc_feature <100..432 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" polyA_site 843 /gene="...
Synonym: claudin-10
XM_046908153.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus claudin 10 (CLDN10), transcript variant X1, mRNA. (843 bp)
CGNC:13756" /db_xref="GeneID:418790" CDS 16..582 /gene="CLDN10" /gene_synonym="claudin-10" /codon_start=1 /product="claudin-10 isoform X1" /protein_id="XP_046797288.1" /db_xref="GeneID:418790" /db_xref="CGNC:13756" /translation="MLISLELWQNEALLLELDFGQRFLKYVCNAADRGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" misc_feature <100..432 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" polyA_site 843 /gene="...
Synonym: claudin-10
XM_046941332.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus claudin 4 (Cldn4), mRNA. (1824 bp)
gene="Cldn4" /note="upstream in-frame stop codon" CDS 192..824 /gene="Cldn4" /codon_start=1 /product="claudin-4" /protein_id="NP_001012022.1" /db_xref="GeneID:304407" /db_xref="RGD:1307932" /translation="MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV" misc_feature 201..701 /gene="Cldn4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN // REFERENCE 1 (bases 1 to 1824) AUTHORS Ren Q,...
NM_001012022.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 1, mRNA. (2194 bp)
misc_feature 257..319 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 293..946 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" misc_feature 368..370 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_171826.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 6, mRNA. (2209 bp)
misc_feature 272..334 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 308..961 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" misc_feature 383..385 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001356488.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 3 (CLDN3), mRNA. (1175 bp)
gene="CLDN3" /gene_synonym="claudin-3" /inference="alignment:Splign:2.1.0" CDS 87..731 /gene="CLDN3" /gene_synonym="claudin-3" /codon_start=1 /product="claudin-3" /protein_id="NP_989533.1" /db_xref="CGNC:49012" /db_xref="GeneID:374029" /translation="MSMGLEIGGVALSVLGWLCSIICCALPMWRVTAFIGNNIVTAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALLVVAIVLAVLGLMVAIVGAQCTRCVEDETTKAKITIVSGVIFLLSGIMTLIPVSWSANTIIRDFYNPLVIDAQKRELGTSLYVGWAASALLLFGGALLCCSCPPKDERYAPSKVAYSAPRSAVTSYDKRNYV" misc_feature 93..593 /gene="CLDN3" /gene_synonym="claudin-3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-3
NM_204202.2 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 2, mRNA. (2187 bp)
protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature 286..939 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001252450.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 3, mRNA. (2049 bp)
variant 3; claudin domain-containing protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 3" /protein_id="NP_001239380.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <616..798 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001252451.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 2 (CLDN2), transcript variant X1, mRNA. (2904 bp)
CDS 272..964 /gene="CLDN2" /gene_synonym="claudin-2; OAZON" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_054184059.1" /db_xref="GeneID:9075" /db_xref="HGNC:HGNC:2041" /db_xref="MIM:300520" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV" misc_feature 338..814 /gene="CLDN2" /gene_synonym="claudin-2; OAZON" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-2; OAZON
XM_054328084.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 2 (CLDN2), transcript variant X2, mRNA. (3124 bp)
CDS 492..1184 /gene="CLDN2" /gene_synonym="claudin-2; OAZON" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_054184060.1" /db_xref="GeneID:9075" /db_xref="HGNC:HGNC:2041" /db_xref="MIM:300520" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV" misc_feature 558..1034 /gene="CLDN2" /gene_synonym="claudin-2; OAZON" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-2; OAZON
XM_054328085.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 10 (CLDN10), transcript variant 2, mRNA. (843 bp)
variant 2" /codon_start=1 /product="claudin-10 isoform 2 precursor" /protein_id="NP_001264697.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..427 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-10
NM_001277768.1 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus claudin 16 (Cldn16), mRNA. (1173 bp)
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: claudin-16; PCLN1
NM_053241.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 10 (CLDN10), transcript variant 3, mRNA. (741 bp)
gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" CDS 123..659 /gene="CLDN10" /gene_synonym="claudin-10" /note="isoform 3 is encoded by transcript variant 3" /codon_start=1 /product="claudin-10 isoform 3" /protein_id="NP_001264698.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MNCAGNALGAFHCRPHLTIFKVEGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" misc_feature <180..509 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: claudin-10
NM_001277769.2 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Rattus norvegicus claudin 19 (Cldn19), transcript variant X1, mRNA. (3577 bp)
xref="RGD:1305000" CDS 413..1087 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19 isoform X1" /protein_id="XP_006238818.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLSTSVKGPLGV" misc_feature 422..958 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326"...
Synonym: claudin-19
XM_006238756.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 10 (CLDN10), transcript variant 1, mRNA. (971 bp)
product="claudin-10 isoform 1 precursor" /protein_id="NP_001264696.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 24..92 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 42..560 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-10
NM_001277767.2 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 4, non-coding RNA. (2143 bp)
08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..734 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 735..2143 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2143) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NR_045517.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Danio rerio claudin 7b (cldn7b), mRNA. (1976 bp)
synonym="cb388; claudin7; cldn7; fd19f08; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 190..726 /gene="cldn7b" /gene_synonym="cb388; claudin7; cldn7; fd19f08; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: cb388; claudin7; cldn7; fd19f08; wu:fd19f08
NM_131637.2 - Danio rerio (zebrafish) - NCBI - UCSC
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 5, non-coding RNA. (2005 bp)
exon 176..485 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..2005 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2005) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NR_045518.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Sorex fumeus claudin 4 (CLDN4), mRNA. (630 bp)
note="claudin 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins" /db_xref="GeneID:130017544" CDS 1..630 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="XP_055964215.1" /db_xref="GeneID:130017544" /translation="MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVVAVLGVLLSVVGGKCTNCVEDEGAKAKTMIVAGVVFLLAGLLVMVPVSWTAHNVIRDFYNPLVSAGQKREMGAGLYIGWAASGLLLLGGALLCCNCPPRADKPYSAKYSAARSGPASNYV" misc_feature 10..504 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family...
XM_056108240.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus claudin 7 (CLDN7), mRNA. (755 bp)
note="claudin 7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:130024430" CDS 1..636 /gene="CLDN7" /codon_start=1 /product="claudin-7" /protein_id="XP_055971146.1" /db_xref="GeneID:130024430" /translation="MANSGLQLLGFAMALLGWVALLACTAIPQWQMSSFAGDNIITSQAMYKGLWMECAIQSTGVMNCKIYDSVLALPASLQATRALMVVSLVLGFMAMIVATMGMKCTNCGGDDKVKKARIAMTGGIIFIVAGLAALIACSWSGNQIVRDFYNPLVPMNVKFEFGPAIFIGWAGSALVLLGGGLLSCSCPRSESKPAYHAPRSYPKPNSAKEYV" misc_feature 10..519 /gene="CLDN7" /note="PMP-22/EMP/MP20/Claudin...
XM_056115171.1 - Sorex fumeus (smoky shrew) - NCBI
Sus scrofa claudin 16 (CLDN16), mRNA. (1741 bp)
map="13" /breed="mixed" gene 1..1741 /gene="CLDN16" /note="claudin 16" /db_xref="GeneID:100302019" CDS 242..949 /gene="CLDN16" /codon_start=1 /product="claudin-16" /protein_id="NP_001155116.2" /db_xref="GeneID:100302019" /translation="MRDLLQYVACFFALFSTGFLVVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADVLAGFGFIILLLGLDCVKFLPDEPYIKVRICFVAGTTLLIAGAPGIIGSVWYAVDVYVERTSLILHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGLERNYPYSMRKAYSTTAVSMAKSYVAPRTQTAKMYAVDTRV" misc_feature 272..790 /gene="CLDN16" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001161644.2 - Sus scrofa (pig) - NCBI
PREDICTED: Sorex fumeus claudin 11 (CLDN11), mRNA. (709 bp)
note="claudin 11; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:130020093" CDS 6..629 /gene="CLDN11" /codon_start=1 /product="claudin-11" /protein_id="XP_055966711.1" /db_xref="GeneID:130020093" /translation="MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVMCLVGGCVIVCCSGDAQSFGENRFYYSSGSSSPTHAKSAHV" misc_feature 21..521 /gene="CLDN11" /note="PMP-22/EMP/MP20/Claudin...
XM_056110736.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus claudin 9 (CLDN9), mRNA. (717 bp)
e="claudin 9; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 28 Proteins" /db_xref="GeneID:130042814" CDS 53..706 /gene="CLDN9" /codon_start=1 /product="claudin-9" /protein_id="XP_055990993.1" /db_xref="GeneID:130042814" /translation="MASTGLELLGMSLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIELTAGVVLLLAGVLVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCSCPPPHLDRARGPRLGYSIPSRSGASGLDKRDYV" misc_feature 62..541 /gene="CLDN9" /note="PMP-22/EMP/MP20/Claudin...
XM_056135018.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus claudin 1 (CLDN1), mRNA. (3215 bp)
note="claudin 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 24 Proteins" /db_xref="GeneID:130030366" CDS 60..695 /gene="CLDN1" /codon_start=1 /product="claudin-1" /protein_id="XP_055977598.1" /db_xref="GeneID:130030366" /translation="MANAGLQLLGFILAFLGWIGAIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGVIAICVATVGMKCMKCLEDDEVQKMRMAVVGGVIFLIAGLALLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPTPSSGKDYV" misc_feature 72..578 /gene="CLDN1" /note="PMP-22/EMP/MP20/Claudin...
XM_056121623.1 - Sorex fumeus (smoky shrew) - NCBI
Xenopus tropicalis claudin 15, gene 1 (cldn15.1), mRNA. (1499 bp)
upstream in-frame stop codon" CDS 321..1022 /gene="cldn15.1" /codon_start=1 /product="claudin-15" /protein_id="NP_001096379.1" /db_xref="GeneID:100124975" /db_xref="Xenbase:XB-GENE-994817" /translation="MSVILETIGFFFGVIGSTMLGITLFNANWRVSSVDGNVITTSTLFENLWMSCATDSTGVYNCREFPSLLALSGYLQASRALMITSLVFGFFSCLLGMIGLQCTKVAEDNPVVKGKLATAAGAISIFGGLCAGIAVSWYAFNITKDFFNPLYPGTKYEIGPALYLGWSGALLDIVGGAILCCSYKTQVSAAKNKYTYNYRAPMTVSSAKAAPQATLPRYESSNSICKYGKNAYV" misc_feature 321..857 /gene="cldn15.1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN // REFERENCE 1...
NM_001102909.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Sorex fumeus claudin 3 (CLDN3), mRNA. (920 bp)
"claudin 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 28 Proteins" /db_xref="GeneID:130017542" CDS 164..823 /gene="CLDN3" /codon_start=1 /product="claudin-3" /protein_id="XP_055964213.1" /db_xref="GeneID:130017542" /translation="MSMGLEITGTSLAVLGWLGTIVCCALPMWRVSAFIGSSIITAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALLVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKIVYSAPRSAAPHTAPSTSYDRKDYV" misc_feature 170..664 /gene="CLDN3" /note="PMP-22/EMP/MP20/Claudin...
XM_056108238.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus claudin 6 (CLDN6), mRNA. (905 bp)
similarity to: 28 Proteins" /db_xref="GeneID:130042813" CDS 240..905 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="XP_055990992.1" /db_xref="GeneID:130042813" /translation="MASAGLQILGVVLALLGWVIALVSCALPLWKVTAFIGSSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLALLVYVAGAKCTTCVEDKDSKARLVLSSGAVFIFSGILVLIPVCWTAHVIIRDFYNPLVVEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGVSRGSSHYMARYSASAPRGPAQGPSEYPTKNYV" misc_feature 252..749 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
XM_056135017.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus claudin 8 (CLDN8), mRNA. (678 bp)
similarity to: 11 Proteins" /db_xref="GeneID:130018656" CDS 1..678 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="XP_055965415.1" /db_xref="GeneID:130018656" /translation="MASYAIQMAGLVLGGVGMVGTIAITIMPQWRVSAFIGSNIVVFETLWEGLWMNCMRHANIRMQCKVYDSLLALPSDLQASRGLMCAACVLAFLAFMTAVLGMKCTRCTGEDQRVKGYILLTAGIVFIVTGVVVLIPVSWVANSIIRDFYNPIVDAAQKRELGEALYLGWTTALVLIAGGALFCCVSCSNGKSGSYRYSIPSHRTTPKSYHTGKKSPSEYSKSQYV" misc_feature 13..546 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
XM_056109440.1 - Sorex fumeus (smoky shrew) - NCBI
Mus musculus claudin 2 (Cldn2), transcript variant 1, mRNA. (3069 bp)
culus claudin 2 (Cldn2), transcript variant 1, mRNA. ACCESSION NM_016675 VERSION NM_016675.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced NM_016675.4. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_016675.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Sorex fumeus claudin 17 (CLDN17), mRNA. (675 bp)
similarity to: 6 Proteins" /db_xref="GeneID:130018666" CDS 1..675 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_055965441.1" /db_xref="GeneID:130018666" /translation="MAFYPLQIAGLVLGFFGLVGTLATTLLPQWRVSAFVGSNIIVFERVWEGLWMNCIRQARVRLQCKFYSSLLALPPVLEAARALMCVAVVLAFIALLIGICGMKQIQCTGANDRAKAYLLGTSGVLFIVTGIFVLIPVCWTANIIIRDFYNPAVHVGQKRELGAALFLGWASTAVLFIAGGLLCGYCCCNRKKQRFRYPAPAYNMPHRDANRNTNMVSKTTTSYV" misc_feature 16..546 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
XM_056109466.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus claudin 2 (CLDN2), mRNA. (3517 bp)
similarity to: 13 Proteins" /db_xref="GeneID:130034233" CDS 330..1022 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="XP_055981777.1" /db_xref="GeneID:130034233" /translation="MASLSLQLIGYLLGLLGLLGTVVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQNSHVKDKVAVVGGVLFFLGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLGGGIILCFSCPSQRNRPNYYDAYQAQPLTTRSSPRPVQPSKTKNEFNSYSLTGYV" misc_feature 393..872 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
XM_056125802.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus claudin 19 (CLDN19), mRNA. (1026 bp)
similarity to: 8 Proteins" /db_xref="GeneID:130032017" CDS 277..951 /gene="CLDN19" /codon_start=1 /product="claudin-19" /protein_id="XP_055979573.1" /db_xref="GeneID:130032017" /translation="MANSGLQLLGYFLALGGWVGIIASTVLPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVADSNPVAKGRVAISGGVLFFLAGLCTVTAVSWYATLVTQEFFNPTTPVNARYEFGPALFVGWASAGLAMLGGSFLCCSCPPPERASSIPQPYRPGPSTAAREPVVKLSASAKGPLGI" misc_feature 286..822 /gene="CLDN19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
XM_056123598.1 - Sorex fumeus (smoky shrew) - NCBI
Xenopus laevis claudin 6, gene 1 L homeolog (cldn6.1.L), mRNA. (894 bp)
L" /gene_synonym="cldn4l2; cldn6; cldn6.1" /codon_start=1 /product="claudin 6, gene 1 L homeolog" /protein_id="NP_001086756.1" /db_xref="GeneID:446591" /db_xref="Xenbase:XB-GENE-959189" /translation="MASTGLQILGMALALIGWVGCIITCAMPMWRVTAFIGNNIVVAQTIWEGLWMNCIVQITGQMQCKVYDSMLALSQDLQAARALTVICILVALLALLIGVVGAKCTNCIEDENTKAKVSMVSGVVYLVAGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAAIYIGWASSTLMLLGGGLLCCSCPKKEDNHYSARYTAAASQPRSDYPSKDYV" misc_feature 54..554 /gene="cldn6.1.L" /gene_synonym="cldn4l2; cldn6; cldn6.1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
Synonym: cldn4l2; cldn6; cldn6.1
NM_001093287.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Sorex fumeus claudin 14 (CLDN14), mRNA. (702 bp)
similarity to: 17 Proteins" /db_xref="GeneID:130028701" CDS 1..702 /gene="CLDN14" /codon_start=1 /product="claudin-14" /protein_id="XP_055975505.1" /db_xref="GeneID:130028701" /translation="MASTAVQLLGFLLSFLGLVGTLLTTVLPHWQRKAHVGSNILTAVSYLKGLWMECVWQATGVYQCQLYRSLLALPRDLQAARALMVVSCLLSAVACVLAVVGMKCTRCAKDTPLKTSLAVAGGVLFMLAGLLCLIPVSWATHNVVRDFFNPLLHNSLKYELGPALYLGFVSASLSLVGGTLLCLSCDMQAASAGGTRGQPRAAPAYRPPAAYKDHRAPSAGSAAHSGYRLNDYV" misc_feature 70..543 /gene="CLDN14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
XM_056119530.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus claudin 16 (CLDN16), mRNA. (708 bp)
similarity to: 7 Proteins" /db_xref="GeneID:130030367" CDS 1..708 /gene="CLDN16" /codon_start=1 /product="claudin-16" /protein_id="XP_055977599.1" /db_xref="GeneID:130030367" /translation="MRDLLQYVACFFALCSTGFLVVATWTDCWMENADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADVLAGFGFITLLLGLNCVKFLPDEPYMKIRICFVAGTTLLIAGAPGIIGSVWYAVDVYVERSSLILHNIFLGIQYKFGWSCWLGMAGSLGCFLAGGLLTCCLYFFKDVKSGRTYPYSRRKSYSTAAVSMAKSYMTRRTETAKMYAVDTRV" misc_feature 31..549 /gene="CLDN16" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
XM_056121624.1 - Sorex fumeus (smoky shrew) - NCBI
Mus musculus claudin 25 (Cldn25), mRNA. (786 bp)
Gm16492; Gm513" /note="claudin 21, pseudogene; claudin 25, pseudogene" /codon_start=1 /product="putative claudin-25" /protein_id="NP_001371194.1" /db_xref="GeneID:100042785" /db_xref="MGI:MGI:3642767" /translation="MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLTLDLNEMETWVSGLWEACVNQEEAGTVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLSSCGLECFRFHRPGGVFKTRLCLLGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLAVGGLLLIFSACLENEDGSSSWMADATAPQACAPVEEEFDGSFHLTPRPVNQVI" misc_feature 124..597 /gene="Cldn25" /gene_synonym="Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513
NM_001384265.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Sorex fumeus claudin 15 (CLDN15), mRNA. (874 bp)
to: 5 Proteins" /db_xref="GeneID:130017500" CDS 164..874 /gene="CLDN15" /codon_start=1 /product="claudin-15" /protein_id="XP_055964173.1" /db_xref="GeneID:130017500" /translation="MSMAVETLGYFLGALGLLMLGVTLPHSQWRVSTVHGNVITTSTIFENLWYSCATDSTGVYNCREFPSLLALSGYLQASRALMITAILLGFLGLLLGVPGLRCTTVGSDVLSRKAKLAATAGVLHILAGFCGMVAISWYAFNITREFFDPLYPGTKYELGPALYLGWSASLMSILGGLCLGVNCCCAPEDEVAPARTWLPYKPPTKPSASVNTRLRPAASVDDVDSSFGKYGKNAYV" misc_feature 242..694 /gene="CLDN15" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
XM_056108198.1 - Sorex fumeus (smoky shrew) - NCBI
Mus musculus claudin 2 (Cldn2), transcript variant 2, mRNA. (2899 bp)
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced XM_006528490.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_001410421.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)

Data Export:


Debug Info:

Redirect URI :
lang : ja | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.115 | 0.115 | count_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.235 | 0.121 | search_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.242 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]