GGRNA ver.2 Help | Advanced search | English    旧バージョン

2017-12-17 14:52:51, GGRNA : RefSeq release 85 (Nov, 2017)




Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
us claudin 11 (Cldn11), mRNA. ACCESSION NM_008770 VERSION NM_008770.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: Claudin-11; Claudin11; Osp; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 19 (Cldn19), mRNA. (1626 bp)
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-19
NM_001008514.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 16 (Cldn16), mRNA. (1173 bp)
musculus claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins are...
Synonym: claudin-16; PCLN1
NM_053241.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Canis lupus familiaris claudin 2 (CLDN2), mRNA. (953 bp)
roduct="claudin-2" /protein_id="NP_001003089.1" /db_xref="GeneID:403649" /db_xref="VGNC:VGNC:39316" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 80..142 /gene="CLDN2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1); transmembrane region" misc_feature 125..601 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family...
NM_001003089.1 - Canis lupus familiaris (dog) - NCBI
Rattus norvegicus claudin 4 (Cldn4), mRNA. (1824 bp)
gene="Cldn4" /note="upstream in-frame stop codon" CDS 192..824 /gene="Cldn4" /codon_start=1 /product="claudin-4" /protein_id="NP_001012022.1" /db_xref="GeneID:304407" /db_xref="RGD:1307932" /translation="MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV" misc_feature 201..701 /gene="Cldn4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation 815 /gene="Cldn4" /replace="c" /replace="t" /...
NM_001012022.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 24 (Cldn24), mRNA. (663 bp)
note="claudin 24" /db_xref="GeneID:502083" /db_xref="RGD:1562043" CDS 1..663 /gene="Cldn24" /gene_synonym="RGD1562043" /note="claudin 22 like" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001103614.1" /db_xref="GeneID:502083" /db_xref="RGD:1562043" /translation="MAFIFKTAMQSVALSLSLLGWVLAITTTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGLCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHSSYLENGTAQPKV" misc_feature 19..540 /gene="Cldn24" /gene_synonym="RGD1562043" /note="PMP-22/EMP/MP20/Claudin...
Synonym: RGD1562043
NM_001110144.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA. (2908 bp)
ynonym="claudin-3; cldn3" /note="upstream in-frame stop codon" CDS 376..1017 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /codon_start=1 /product="claudin 3 L homeolog" /protein_id="NP_001087400.1" /db_xref="GeneID:447224" /db_xref="Xenbase:XB-GENE-6078310" /translation="MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV" misc_feature 382..915 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /note="PMP-22/EMP/MP20/Claudin family...
Synonym: claudin-3; cldn3
NM_001093931.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 8, gene 2 (cldn8.2), mRNA. (2062 bp)
XB-GENE-991592" CDS 31..711 /gene="cldn8.2" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.2" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Sus scrofa claudin 1-like (LOC396566), mRNA. (1012 bp)
replace="a" /replace="t" /db_xref="dbSNP:81402566" CDS 175..810 /gene="LOC396566" /codon_start=1 /product="claudin-1-like" /protein_id="NP_001155107.1" /db_xref="GeneID:396566" /translation="MANAGLQLLGFILAFLGWIGSIVSTALLQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATARYGNRIVQEFYHLMTPVNARYEFGQALFTGWAAASLCLLGGALLCRSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 187..693 /gene="LOC396566" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1 (bases 1 to 1012) AUTHORS Martin-Martin,N...
NM_001161635.1 - Sus scrofa (pig) - NCBI
Xenopus laevis claudin 14 L homeolog (cldn14.L), mRNA. (1338 bp)
gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /codon_start=1 /product="claudin 14 L homeolog" /protein_id="NP_001086045.1" /db_xref="GeneID:444474" /db_xref="Xenbase:XB-GENE-995701" /translation="MASMALQLLGFSVALIGFIGTVVATVLPHWWRTAHVGTNIITAVAYMKGLWMECVWHSTGIYQCQVHQSQLALPRDLQVARAMMVASCVLSVLASVVSVFGMKCTQCAKGSSSKRVIAAFGGVFSALAGLMCLIPVAWSTNDVVQDFYNPGLPYGMKYEIGQALYIGFISGGLSVIGGIMILSTSCQKDSTPLPYTPQRRYPRKTPTSRSQPVNKSNHVPSWSSASHHGYHLNDFV" misc_feature 70..600 /gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-14; cldn14; DFNB29
NM_001092576.1 - Xenopus laevis (African clawed frog) - NCBI
Pan troglodytes claudin 11 (CLDN11), mRNA. (2174 bp)
="claudin-11" /note="upstream in-frame stop codon" CDS 200..823 /gene="CLDN11" /gene_synonym="claudin-11" /note="claudin 11 (oligodendrocyte transmembrane protein)" /codon_start=1 /product="claudin-11" /protein_id="NP_001233342.1" /db_xref="GeneID:460846" /db_xref="VGNC:VGNC:1780" /translation="MVATFLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV" misc_feature 215..715 /gene="CLDN11" /gene_synonym="claudin-11" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-11
NM_001246413.1 - Pan troglodytes (chimpanzee) - NCBI
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 19 S homeolog (cldn19.S), mRNA. (1944 bp)
"claudin-19; cldn19" /note="upstream in-frame stop codon" CDS 309..974 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /codon_start=1 /product="claudin 19 S homeolog" /protein_id="NP_001088886.1" /db_xref="GeneID:496231" /db_xref="Xenbase:XB-GENE-954660" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIAVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNDERRGQQYYRQSQPSATTREITKMPAKNKEETS" misc_feature 318..854 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-19; cldn19
NM_001095417.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog (cldn5.S), mRNA. (1060 bp)
gene="cldn5.S" /gene_synonym="claudin-5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog" /protein_id="NP_001085820.1" /db_xref="GeneID:444247" /db_xref="Xenbase:XB-GENE-17332561" /translation="MASVGMEILGLSLSTLGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALSPELQAGRALTVLASMVGLIGLLVTVVGAKCTNCLHGSSVKGRVLLAGGIIYILCGILVLIPLCWIANIIITEFYDPRVPAPQKREMGAALYVGWAATSLLMLGGSLLCGSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 180..677 /gene="cldn5.S" /gene_synonym="claudin-5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-5
NM_001092351.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA. (1995 bp)
synonym="claudin-19" /note="upstream in-frame stop codon" CDS 248..880 /gene="cldn19.L" /gene_synonym="claudin-19" /codon_start=1 /product="uncharacterized protein LOC494684" /protein_id="NP_001087995.1" /db_xref="GeneID:494684" /db_xref="Xenbase:XB-GENE-17346338" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV" misc_feature 257..793 /gene="cldn19.L" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family;...
Synonym: claudin-19
NM_001094526.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Sus scrofa claudin 6 (CLDN6), mRNA. (746 bp)
chromosome="3" /map="3" gene 1..746 /gene="CLDN6" /note="claudin 6" /db_xref="GeneID:100302020" CDS 19..684 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="NP_001155117.1" /db_xref="GeneID:100302020" /translation="MASAGLQILGIVLTLFGWVNALVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLSGAKCTTCVEDKDTKARLVLTSGIIFVLSGVLTLIPVCWTAHAIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGRSQGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 31..528 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement...
NM_001161645.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus claudin 18 (Cldn18), mRNA. (1574 bp)
note="claudin 18-like" /codon_start=1 /product="claudin-18 precursor" /protein_id="NP_001014118.1" /db_xref="GeneID:315953" /db_xref="RGD:1359696" /translation="MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLTSGIMFIISGVCAIIGVSVFANMLVTNFWMSTANMYSGMGGMVQTVQTRYTFGAALFVGWIAGGLTLIGGVMMCIACRGLTPDDRNFKAVSYHASGQNVAYKPGGFKASTGFGSNARNKKIYDGGARTEDDEQSHPTKYDYV" sig_peptide 33..101 /gene="Cldn18" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature <159..605 /gene="Cldn18" /note="PMP-22/EMP/MP20/Claudin family;...
NM_001014096.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 6, gene 2 L homeolog (cldn6.2.L), mRNA. (933 bp)
synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="claudin4L1" /codon_start=1 /product="claudin 6, gene 2 L homeolog" /protein_id="NP_001082332.1" /db_xref="GeneID:398409" /db_xref="Xenbase:XB-GENE-1009651" /translation="MASTGLQVLGMAMSIIGWVGCIITCAMPMWRVTAFIGNNIVVAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALTVICILVALLAMLVGIVGAKCTNCIEDENTKAKVSMVSGVVFLVAGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAAIYIGWASSALMLLGGGLLCCSCPKKNDAPYSARYTAPSGPARSDYPSKNYV" misc_feature 61..567 /gene="cldn6.2.L" /gene_synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA
NM_001088863.1 - Xenopus laevis (African clawed frog) - NCBI
Rattus norvegicus claudin 5 (Cldn5), mRNA. (1442 bp)
map="11q23" gene 1..1442 /gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV" misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
NM_031701.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 12 S homeolog (cldn12.S), mRNA. (1179 bp)
LOCUS NM_001095510 1179 bp mRNA linear VRT 29-OCT-2016 DEFINITION Xenopus laevis claudin 12 S homeolog (cldn12.S), mRNA. ACCESSION NM_001095510 VERSION NM_001095510.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC088962.1. ##Evidence-Data-START## Transcript exon combination ::...
Synonym: claudin-12; cldn12
NM_001095510.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 12 (cldn12), mRNA. (2983 bp)
LOCUS NM_001016851 2983 bp mRNA linear VRT 28-OCT-2016 DEFINITION Xenopus tropicalis claudin 12 (cldn12), mRNA. ACCESSION NM_001016851 NM_001015839 VERSION NM_001016851.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CR855430.2. On or before Oct 7, 2010 this sequence...
Synonym: claudin-12
NM_001016851.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog (cldn5.L), mRNA. (2376 bp)
cldn5.L" /gene_synonym="claudin-5; cldn5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog" /protein_id="NP_001083445.1" /db_xref="GeneID:398929" /db_xref="Xenbase:XB-GENE-6078354" /translation="MASAAMEIIGLSLSILGWIGVILTCGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALHPELQAGRALTVLASIVGLVGLLVTIVGAKCTNCLQGSSVKSRVLLAGGIIYIVCGILLLVPLCWIANIVITEFYDPRVPASQKREMGAALYIGWGATSLLLLGGSLLCCSFAMKDGISNLPVKYSAPRIPTSNGDYDKKNYV" misc_feature 103..594 /gene="cldn5.L" /gene_synonym="claudin-5; cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-5; cldn5
NM_001089976.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. (989 bp)
DEFINITION Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. ACCESSION NM_001193619 VERSION NM_001193619.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL596185.12. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
NM_001193619.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 8 (Cldn8), mRNA. (2285 bp)
map="11q11" gene 1..2285 /gene="Cldn8" /note="claudin 8" /db_xref="GeneID:304124" /db_xref="RGD:1308575" CDS 3..680 /gene="Cldn8" /codon_start=1 /product="claudin-8" /protein_id="NP_001032863.1" /db_xref="GeneID:304124" /db_xref="RGD:1308575" /translation="MATYALQMAALVLGGVGMVGTVAVTIMPQWRVSAFIESNIVVFENRWEGLWMNCMRHANIRMQCKVYDSLLALSPDLQASRGLMCAASVLSFLAFMTAILGMKCTRCTGEDENVKSRILLTAGIIFFITGLVVLIPVSWVANAIIRDFYNPLVDVAQKRELGEALYIGWTTALVLIAGGALFCCVFCCTERSNSYKYSVPSHRTTQRSFHAEKRSPSIYSKSQYV" misc_feature 15..548 /gene="Cldn8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="...
NM_001037774.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 7 (Cldn7), transcript variant 1, mRNA. (1311 bp)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_016887.6 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 10 (CLDN10), transcript variant 3, mRNA. (826 bp)
="claudin-10" /note="claudin 10" /db_xref="CGNC:13756" /db_xref="GeneID:418790" CDS 24..560 /gene="CLDN10" /gene_synonym="claudin-10" /note="isoform 3 is encoded by transcript variant 3" /codon_start=1 /product="claudin-10 isoform 3" /protein_id="NP_001264698.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MNCAGNALGAFHCRPHLTIFKVEGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" misc_feature <81..410 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-10
NM_001277769.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus claudin 2 (Cldn2), mRNA. (3052 bp)
CDS 349..1041 /gene="Cldn2" /gene_synonym="RGD1560247" /codon_start=1 /product="claudin-2" /protein_id="NP_001100316.1" /db_xref="GeneID:300920" /db_xref="RGD:1560247" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV" misc_feature 361..891 /gene="Cldn2" /gene_synonym="RGD1560247" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" STS 349..1041 /gene="Cldn2" /...
Synonym: RGD1560247
NM_001106846.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 10 (CLDN10), transcript variant 1, mRNA. (963 bp)
product="claudin-10 isoform 1 precursor" /protein_id="NP_001264696.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..547 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-10
NM_001277767.1 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. (1517 bp)
LOCUS NM_001141277 1517 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. ACCESSION NM_001141277 VERSION NM_001141277.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT048904.1. ##Evidence-Data-START## Transcript...
NM_001141277.1 - Salmo salar (Atlantic salmon) - NCBI
Rattus norvegicus claudin 3 (Cldn3), mRNA. (1501 bp)
stop codon" CDS 441..1100 /gene="Cldn3" /note="RVP1; ventral prostate.1 protein" /codon_start=1 /product="claudin-3" /protein_id="NP_113888.2" /db_xref="GeneID:65130" /db_xref="RGD:68425" /translation="MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALLCCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV" misc_feature 447..941 /gene="Cldn3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" misc_feature 465..527 /gene="Cldn3" /experiment...
NM_031700.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 10 (CLDN10), transcript variant 2, mRNA. (843 bp)
variant 2" /codon_start=1 /product="claudin-10 isoform 2 precursor" /protein_id="NP_001264697.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..427 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-10
NM_001277768.1 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar Claudin-14 (cld14), mRNA. (1872 bp)
LOCUS NM_001140323 1872 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-14 (cld14), mRNA. ACCESSION NM_001140323 VERSION NM_001140323.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT045650.1. ##Evidence-Data-START## Transcript exon combination...
NM_001140323.1 - Salmo salar (Atlantic salmon) - NCBI
Oryctolagus cuniculus claudin 12 (CLDN12), mRNA. (735 bp)
LOCUS NM_001171276 735 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus claudin 12 (CLDN12), mRNA. ACCESSION NM_001171276 VERSION NM_001171276.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000945.1. FEATURES Location/...
NM_001171276.1 - Oryctolagus cuniculus (rabbit) - NCBI
Rattus norvegicus claudin 9 (Cldn9), mRNA. (1460 bp)
gene="Cldn9" /note="upstream in-frame stop codon" CDS 364..1017 /gene="Cldn9" /codon_start=1 /product="claudin-9" /protein_id="NP_001011889.1" /db_xref="GeneID:287099" /db_xref="RGD:1308999" /translation="MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 373..816 /gene="Cldn9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" STS 364..1017 /gene="Cldn9" /standard_name="...
NM_001011889.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 6 (Cldn6), mRNA. (1544 bp)
CDS 132..791 /gene="Cldn6" /codon_start=1 /product="claudin-6 precursor" /protein_id="NP_001095834.1" /db_xref="GeneID:287098" /db_xref="RGD:1308837" /translation="MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLIVLLGLLLYLAGAKCTTCVEDKNSKSRLVLISGVIFVISGVLTLIPICWTAHAIIQDFYNPLVADAQKRELGASLYLGWAASGLLLIGGGLLCCACSSGGTQGPSHYVARYSSPVPHSRGPSEYPSKNYV" sig_peptide 132..194 /gene="Cldn6" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 141..641 /gene="Cldn6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001102364.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 10 (Cldn10), mRNA. (1331 bp)
NM_001106058.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 17 (Cldn17), mRNA. (1177 bp)
Cldn17" /note="upstream in-frame stop codon" CDS 140..814 /gene="Cldn17" /codon_start=1 /product="claudin-17" /protein_id="NP_001100582.1" /db_xref="GeneID:304125" /db_xref="RGD:1307462" /translation="MAFYPVQIAGLVLGFFGLVGTVGTTLLPQWRVSAFIGSNIIIFERIWEGLWMNCIQQAMVTLQCKFYNSILALPPVLEAARALMCVAMALSLVALIIGICGMKQIECTSSSERVKAYLLGTSGVLFIVTGIFVLIPVSWTANIIIRDFYDPTIHAGQKRELGGALFLGWATAAVLFIAGGLLCGYCCCNRKEQWHGYPVSAYRVPPKDSQRKVTVPRKTSTSYV" misc_feature 155..685 /gene="Cldn17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(364) /gene="Cldn17" /...
NM_001107112.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 1 (Cldn1), mRNA. (3275 bp)
Cldn1" /note="claudin 1" /db_xref="GeneID:65129" /db_xref="RGD:68422" variation 112 /gene="Cldn1" /replace="c" /replace="g" /db_xref="dbSNP:199224331" CDS 180..815 /gene="Cldn1" /codon_start=1 /product="claudin-1" /protein_id="NP_113887.2" /db_xref="GeneID:65129" /db_xref="RGD:68422" /translation="MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFVISGLATLVATAWYGNRIVQEFYDPMTPINARYEFGQALFTGWAAASLCLLGGALLSCSCPRKTTSYPTPRPYPKPTPSTGKDYV" misc_feature 192..725 /gene="Cldn1" /note="PMP-22/EMP/MP20/Claudin family; Region:...
NM_031699.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Papio anubis claudin 12 (CLDN12), mRNA. (735 bp)
LOCUS NM_001168990 735 bp mRNA linear PRI 11-SEP-2012 DEFINITION Papio anubis claudin 12 (CLDN12), mRNA. ACCESSION NM_001168990 VERSION NM_001168990.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Papio. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000509.1. FEATURES...
NM_001168990.1 - Papio anubis (olive baboon) - NCBI
Rattus norvegicus claudin 7 (Cldn7), mRNA. (1141 bp)
codon" CDS 306..941 /gene="Cldn7" /codon_start=1 /product="claudin-7 precursor" /protein_id="NP_113890.1" /db_xref="GeneID:65132" /db_xref="RGD:68432" /translation="MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALPAATQATRALMIVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMTGGIIFIVAGLAALVACSWIGHQIVTDFYNPLTPMNIKYEFGPAIFIGWAGSALVLLGGALLSCSCPGSESKAAYRAPRSYPKSNSSKEYV" sig_peptide 306..377 /gene="Cldn7" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 315..818 /gene="Cldn7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /db_xref="CDD...
NM_031702.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 14 (Cldn14), mRNA. (1549 bp)
note="upstream in-frame stop codon" CDS 481..1200 /gene="Cldn14" /codon_start=1 /product="claudin-14" /protein_id="NP_001013447.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 547..1023 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 507..751 /gene="Cldn14" /...
NM_001013429.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 34 (CLDN34), transcript variant X1, mRNA. (1501 bp)
Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1501 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="X" gene 1..1501 /gene="CLDN34" /gene_synonym="Claudin-34" /note="claudin 34; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="...
Synonym: Claudin-34
XM_006724448.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. (633 bp)
LOCUS XM_003515547 633 bp mRNA linear ROD 27-MAY-2016 DEFINITION PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. ACCESSION XM_003515547 VERSION XM_003515547.1 DBLINK BioProject: PRJNA72741 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_003515547.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. (633 bp)
LOCUS XM_007629252 633 bp mRNA linear ROD 27-MAY-2016 DEFINITION PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. ACCESSION XM_007629252 VERSION XM_007629252.1 DBLINK BioProject: PRJNA239316 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_007629252.1 - Cricetulus griseus (Chinese hamster) - NCBI
Macaca mulatta claudin 4 (CLDN4), mRNA. (1820 bp)
gene="CLDN4" /gene_synonym="claudin-4" /note="upstream in-frame stop codon" CDS 341..970 /gene="CLDN4" /gene_synonym="claudin-4" /codon_start=1 /product="claudin-4" /protein_id="NP_001181493.1" /db_xref="GeneID:716808" /translation="MASMGLQVTGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLLVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV" misc_feature 350..850 /gene="CLDN4" /gene_synonym="claudin-4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
Synonym: claudin-4
NM_001194564.2 - Macaca mulatta (Rhesus monkey) - NCBI
PREDICTED: Enhydra lutris kenyoni claudin 34 (LOC111157088), mRNA. (660 bp)
similarity to: 3 Proteins" /db_xref="GeneID:111157088" CDS 13..660 /gene="LOC111157088" /codon_start=1 /product="claudin-34" /protein_id="XP_022374022.1" /db_xref="GeneID:111157088" /translation="MLLLINSANCQVAGFAMATVGWILTTTSMGLVEWRVWYIENNALMPPGLVCVGMWKVCVYHHVSDHNKVTLCQRYSYRDPYLPLDIRVSQNLLLIASILGLLGRASIIFALRNAYLGILRENATFNPFVASGILNLASGICIAITVVWNYHSVMSEQGISFPPSLLIPFKPNTQEIGSAFLVACLAAFMMLLSGVIFLSHKFSTATQVHPQTSDT" misc_feature 70..609 /gene="LOC111157088" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" ORIGIN //...
XM_022518314.1 - Enhydra lutris kenyoni - NCBI
Macaca mulatta claudin 8 (CLDN8), mRNA. (2155 bp)
on alignments. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2155 JSUE03027248.1 46718-48872 FEATURES Location/Qualifiers source 1..2155 /organism="Macaca mulatta" /mol_type="mRNA" /db_xref="taxon:9544" /chromosome="3" /map="3" gene 1..2155 /gene="CLDN8" /gene_synonym="Claudin-8" /note="claudin 8" /db_xref="GeneID:705345" variation 51 /gene="CLDN8" /gene_synonym="Claudin-8" /replace="c" /replace="t" /db_xref="dbSNP:1066346164" variation 73 /gene="CLDN8" /gene_synonym="Claudin-8" /replace="a" /replace="t" /db_xref="dbSNP:290417829" misc_feature 206..208 /gene="CLDN8" /gene_synonym...
Synonym: Claudin-8
NM_001194152.1 - Macaca mulatta (Rhesus monkey) - NCBI
Salmo salar Claudin-5 (cld5), mRNA. (1344 bp)
LOCUS NM_001146383 1344 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-5 (cld5), mRNA. ACCESSION NM_001146383 VERSION NM_001146383.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT056482.1. ##Evidence-Data-START## Transcript exon combination ::...
NM_001146383.1 - Salmo salar (Atlantic salmon) - NCBI
PREDICTED: Enhydra lutris kenyoni claudin 6 (LOC111156182), mRNA. (666 bp)
to: 1 mRNA, 34 Proteins" /db_xref="GeneID:111156182" CDS 1..666 /gene="LOC111156182" /codon_start=1 /product="claudin-6" /protein_id="XP_022372609.1" /db_xref="GeneID:111156182" /translation="MASAGLQILGIVLTLLGWVNALVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLVALLGLLVYLAGAKCTTCVEDKDSKARLVLVSGIIFVISGVLILIPVCWTAHAIIRDFYNPLVSDAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPNHYMARYSASAAHATSQGAPEYPTKNYV" misc_feature 13..510 /gene="LOC111156182" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" ORIGIN //...
XM_022516901.1 - Enhydra lutris kenyoni - NCBI

Data Export:


Debug Info:

Redirect URI :
lang : ja | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.134 | 0.133 | count_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.249 | 0.115 | search_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.255 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]