2024-04-26 13:01:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001161636 893 bp mRNA linear MAM 20-FEB-2022 DEFINITION Sus scrofa claudin 5 (CLDN5), mRNA. ACCESSION NM_001161636 VERSION NM_001161636.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus. REFERENCE 1 (bases 1 to 893) AUTHORS Dalmasso AP, Goldish D, Benson BA, Tsai AK, Wasiluk KR and Vercellotti GM. TITLE Interleukin-4 induces up-regulation of endothelial cell claudin-5 through activation of FoxO1: role in protection from complement-mediated injury JOURNAL J Biol Chem 289 (2), 838-847 (2014) PUBMED 24280217 REMARK GeneRIF: Data show that IL-4 induces upregulation of the junction protein claudin-5 in endothelial cells (ECs) through activation of Jak/STAT6 and phosphorylation and translocation of FoxO1 from the nucleus to the cytoplasm. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from FJ873112.1. ##Evidence-Data-START## Transcript is intronless :: FJ873112.1, CJ032030.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..893 /organism="Sus scrofa" /mol_type="mRNA" /db_xref="taxon:9823" /chromosome="14" /map="14" gene 1..893 /gene="CLDN5" /note="claudin 5" /db_xref="GeneID:396997" /db_xref="VGNC:VGNC:107377" exon 1..893 /gene="CLDN5" /inference="alignment:Splign:2.1.0" CDS 101..757 /gene="CLDN5" /codon_start=1 /product="claudin-5" /protein_id="NP_001155108.1" /db_xref="GeneID:396997" /db_xref="VGNC:VGNC:107377" /translation="
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVGAVLLALVALFVTLAGAQCTTCVAPGPGKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPMSQKYELGAALYIGWAASALLMCGGGLVCCGAWLCAGRPDLGFPVKYSAPRRPTATGDYDKKNYV"
misc_feature 113..640 /gene="CLDN5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
tcgaggctgtgctgagaagccgcgggtccgggggactgagggagtgagccgtgcgcgcccggaggccccgggccgtcgggcgcgcgtcttgtctccagccatgggttcggcagcgctggaaatcctcggcctcgtgctgtgcctggtgggctgggtaggcctgatcctggcgtgcgggctgcccatgtggcaggtaaccgccttcctggaccacaacatcgtgacggcgcagaccacttggaaggggctgtggatgtcctgcgtggtgcagagcacggggcatatgcagtgcaaggtgtacgactcggtgctggcgctgagcaccgaagtgcaggcagcgcgggccctcaccgtcggcgcagtgctgctggcgctcgttgcgctcttcgtgaccttggcaggtgcgcagtgcaccacctgcgtggcccccggcccgggcaaggcacgcgtagctctcacaggcggcgcgctctacgcgctctgcgggctgctggcgctcgtgccactctgctggttcgccaacatcgtggtccgcgagttctacgacccgactgtgcccatgtcgcagaagtacgagctgggcgccgccctctacatcggctgggccgcctcggcgctgctcatgtgtggaggcggcctcgtgtgctgtggtgcctggctctgtgccggccgccccgacctcggcttccctgtcaagtattcggccccgcggcggcccacggccaccggcgactacgacaagaagaactacgtctgagggtgtcgggcacaacagggccgcgagctggactagccagaggaactccgctttggagggcggccttcgctggagtgcgcggcgcactggctccgcagaactcccagctctgtgcccagaccagactttgcccgca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]