GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-12-08 15:16:22, GGRNA : RefSeq release 214 (Sep, 2022)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC003688.1, AJ011497.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185022.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin 15-like b (cldn15lb), mRNA. (1765 bp)
sample supports all introns SAMN00774075, SAMN16830759 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1765 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..1765 /gene="cldn15lb" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="claudin 15-like b" /db_xref="GeneID:108278410" exon 1..879 /gene="cldn15lb" /gene_synonym="Claudin-10; CLDN10; CLDN26" /inference="alignment:Splign:2.1.0" misc_feature 810..812 /gene="cldn15lb" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="upstream in-frame stop codon" exon...
Synonym: Claudin-10; CLDN10; CLDN26
NM_001329305.1 - Ictalurus punctatus (channel catfish) - NCBI
Canis lupus familiaris claudin 3 (CLDN3), mRNA. (1006 bp)
AF358908.1, SRR10915302.2005862.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1006 /organism="Canis lupus familiaris" /mol_type="mRNA" /sub_species="familiaris" /db_xref="taxon:9615" /chromosome="6" /map="6" gene 1..1006 /gene="CLDN3" /gene_synonym="Claudin-3" /note="claudin 3" /db_xref="GeneID:403648" /db_xref="VGNC:VGNC:39319" exon 1..1006 /gene="CLDN3" /gene_synonym="Claudin-3" /inference="alignment:Splign:2.1.0" misc_feature 56..58 /gene="CLDN3" /gene_synonym="Claudin-3" /note="upstream in-frame stop codon" CDS 209..865 /gene="CLDN3" /gene_synonym="Claudin...
Synonym: Claudin-3
NM_001003088.1 - Canis lupus familiaris (dog) - NCBI
Ictalurus punctatus claudin 15a (cldn15a), mRNA. (1474 bp)
Data-START## Transcript exon combination :: KM870792.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1474 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="7" /map="7" gene 1..1474 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="claudin 15a" /db_xref="GeneID:108267636" misc_feature 222..224 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="upstream in-frame stop codon" CDS 282..953 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="claudin 15" /codon_start=1 /product="claudin-15a" /protein_id="NP...
Synonym: Claudin-15; cldn15
NM_001329306.1 - Ictalurus punctatus (channel catfish) - NCBI
Canis lupus familiaris claudin 2 (CLDN2), mRNA. (953 bp)
AF358907.1, SRR10915301.2076305.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..953 /organism="Canis lupus familiaris" /mol_type="mRNA" /sub_species="familiaris" /db_xref="taxon:9615" /chromosome="X" /map="X" gene 1..953 /gene="CLDN2" /gene_synonym="Claudin-2" /note="claudin 2" /db_xref="GeneID:403649" /db_xref="VGNC:VGNC:39316" exon 1..953 /gene="CLDN2" /gene_synonym="Claudin-2" /inference="alignment:Splign:2.1.0" CDS 59..751 /gene="CLDN2" /gene_synonym="Claudin-2" /note="localizes to tight junctions; integral membrane protein claudin-2" /codon_start=1 /product="...
Synonym: Claudin-2
NM_001003089.1 - Canis lupus familiaris (dog) - NCBI
Rattus norvegicus claudin 19 (Cldn19), mRNA. (1626 bp)
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-19
NM_001008514.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 1, mRNA. (2194 bp)
misc_feature 257..319 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 293..946 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" misc_feature 368..370 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_171826.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 6, mRNA. (2209 bp)
misc_feature 272..334 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 308..961 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" misc_feature 383..385 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001356488.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 2, mRNA. (2187 bp)
protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature 286..939 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001252450.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 3, mRNA. (2049 bp)
variant 3; claudin domain-containing protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 3" /protein_id="NP_001239380.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <616..798 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001252451.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 4, non-coding RNA. (2143 bp)
08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..734 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 735..2143 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2143) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NR_045517.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 5, non-coding RNA. (2005 bp)
exon 176..485 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..2005 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2005) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NR_045518.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 17 (Cldn17), mRNA. (1172 bp)
musculus claudin 17 (Cldn17), mRNA. ACCESSION NM_181490 VERSION NM_181490.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK048287.1. On Apr 5, 2007 this sequence version replaced NM_181490.2. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_181490.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Hydra vulgaris claudin-18-like (LOC100204274), mRNA. (1533 bp)
Location/Qualifiers source 1..1533 /organism="Hydra vulgaris" /mol_type="mRNA" /db_xref="taxon:6087" /chromosome="8" /map="8" gene 1..1533 /gene="LOC100204274" /gene_synonym="CLDNL1" /note="claudin-18-like" /db_xref="GeneID:100204274" misc_feature 182..184 /gene="LOC100204274" /gene_synonym="CLDNL1" /note="upstream in-frame stop codon" CDS 257..904 /gene="LOC100204274" /gene_synonym="CLDNL1" /note="Claudin-like 1" /codon_start=1 /product="claudin-18-like" /protein_id="NP_001306642.1" /db_xref="GeneID:100204274" /translation="...
Synonym: CLDNL1
NM_001319713.1 - Hydra vulgaris (swiftwater hydra) - NCBI
Ictalurus punctatus claudin e (cldne), mRNA. (1796 bp)
in-frame stop codon" CDS 619..1257 /gene="cldne" /gene_synonym="CLDN28a" /note="claudin 28a" /codon_start=1 /product="claudin e" /protein_id="NP_001316228.1" /db_xref="GeneID:108280691" /translation="MVSMCRQMLGYGLGIIGFLGTIIVCALPMWKVTAFIGANIVTAQIIWEGLWMTCVMQSTGQMQCKIYDSMLALPQDLQAARALIIISIIVCLFAMILGINGGKCTNFVENESKKIKVAIASGVTFIIAGVLCLIPVCWSTNTIIQDFYSPMVNSAQKRELGAALYIGFGTAALLILGGGLLCSSCPPQEEKNYNNGYKYSQPRSIANSKAYV" misc_feature 628..1119 /gene="cldne" /gene_synonym="CLDN28a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1...
Synonym: CLDN28a
NM_001329299.1 - Ictalurus punctatus (channel catfish) - NCBI
Mus musculus claudin 9 (Cldn9), mRNA. (1443 bp)
ulus claudin 9 (Cldn9), mRNA. ACCESSION NM_020293 VERSION NM_020293.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC154766.2. On Aug 6, 2010 this sequence version replaced NM_020293.2. Summary: This intronless gene encodes a member of the claudin family. Claudins...
Synonym: nmf329
NM_020293.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 22 (Cldn22), mRNA. (1027 bp)
Cldn22" /note="claudin 22" /db_xref="GeneID:306454" /db_xref="RGD:1305271" exon 1..1027 /gene="Cldn22" /inference="alignment:Splign:2.1.0" CDS 64..726 /gene="Cldn22" /codon_start=1 /product="claudin-22" /protein_id="NP_001103613.1" /db_xref="GeneID:306454" /db_xref="RGD:1305271" /translation="MGLVFRTATQSAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHQQHLELKQANPEV" misc_feature <208..612 /gene="Cldn22" /note="PMP-22/EMP/MP20/Claudin family; Region...
NM_001110143.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin g (cldng), mRNA. (1479 bp)
in-frame stop codon" CDS 226..855 /gene="cldng" /gene_synonym="CLDN32c" /note="claudin 32c" /codon_start=1 /product="claudin-like protein ZF-A9" /protein_id="NP_001316180.1" /db_xref="GeneID:108258891" /translation="MSAGLQMLGTALGVVGWLGTILACALPLWRVTAFIGNNIVTAQVVSEGLWMTCVTQSTGQMQCKVYDSMLALSSDLQTSRAILVITLLVMLVAILASIAGGECTNCLAQGTAKARVATAAGVFFLLAGILSLVPPSWIANTVIKDFYDPLVAQSQKRELGASIFICWGAAVLMVIGGGLLCTSWPSGRGCQMGHYKPASQTSRERAAYV" misc_feature 235..765 /gene="cldng" /gene_synonym="CLDN32c" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE...
Synonym: CLDN32c
NM_001329251.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-4-like (LOC108258715), mRNA. (1490 bp)
stop codon" CDS 269..925 /gene="LOC108258715" /gene_synonym="CLDN31a" /note="claudin 31a" /codon_start=1 /product="claudin-4-like" /protein_id="NP_001316179.1" /db_xref="GeneID:108258715" /translation="MATTGLQVLGLLVSIAGWVGGILVCAAPFWRVSAFVADELVVSQVLWEGLWMTCLSQLGRIQCKVYDSALALSGSTQFCRVMVILSILFGLLAVPLGVIGMKCTHCIEGARDVKTRLVRTAGGIFMAAGVAFFLPIFWTTFSVIRDFYDPNVAPPLKRELGPALYLGGGVAFMMLVGGVMLYQGGSAPSGVPTKPTFGKGAGPAKDNPTEGKQDKAYV" misc_feature 278..811 /gene="LOC108258715" /gene_synonym="CLDN31a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN31a
NM_001329250.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-14-like (LOC108261078), mRNA. (2836 bp)
gene="LOC108261078" /gene_synonym="CLDN14a" /note="claudin 14a" /codon_start=1 /product="claudin-14-like" /protein_id="NP_001316186.1" /db_xref="GeneID:108261078" /translation="MGIMAQQFLGFFLGLLGLVGTLTSTVLPHWRQTAYFSTNFLTASYYMKGLWMECVSHTAGIYQCEFHRSMLSLPKDLLAARILMVLSSTTSILAAIVSAVGMKCTRCVQQSHAKGSIAVSGGSCFVLAGLFCLITTSWTTCDVIKDAYDLFSTVGMKYEIGLAVYISFSSAIFSICGGGMLCVASWDVRNYVSHKVADPQVPSPNKLQHPAACQANAAFESDHSSSPTFSLISEYRLSDSISESSIKSKT" misc_feature 1964..2452 /gene="LOC108261078" /gene_synonym="CLDN14a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN...
Synonym: CLDN14a
NM_001329257.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin 26 (cldn26), mRNA. (1510 bp)
gene_synonym="CLDN33c; si:dkey-98f17.3" /note="claudin 33c" /codon_start=1 /product="uncharacterized protein LOC793143 homolog" /protein_id="NP_001316176.1" /db_xref="GeneID:108255719" /translation="MYRERKEPELTMVLLTTKIVQRASLFVAFGGLVTTFITTFLPLWKTMNSELNEMENWYEGLWHMCIFTEEVGLHCKAFESLLALPPVTLASRILMCVSIATGFLGVLAAFFGLDGVEIGAGRDRLKRGLLILGGVLIWVSGLTTLAPVSLIAYVMVVEFWDGGLPDVMPRWEYGEAMFSAWFSGLLLVIGGSFIFVAVCMRDHEEKQQREIFSPAHELQPRTQHYLKTEVL" misc_feature 727..1227 /gene="cldn26" /gene_synonym="CLDN33c; si:dkey-98f17.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: CLDN33c; si:dkey-98f17.3
NM_001329247.1 - Ictalurus punctatus (channel catfish) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. (1035 bp)
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160098.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 3, mRNA. (3752 bp)
DEFINITION Mus musculus claudin 12 (Cldn12), transcript variant 3, mRNA. ACCESSION NM_001193660 VERSION NM_001193660.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY012969.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane...
NM_001193660.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 4, mRNA. (3639 bp)
musculus claudin 12 (Cldn12), transcript variant 4, mRNA. ACCESSION NM_001193661 VERSION NM_001193661.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY018558.1, AK166110.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001193661.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v2, mRNA. (1092 bp)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160097.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. (1143 bp)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160096.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 2, mRNA. (3804 bp)
musculus claudin 12 (Cldn12), transcript variant 2, mRNA. ACCESSION NM_001193659 VERSION NM_001193659.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB845860.1, AK039672.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001193659.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. (852 bp)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160099.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin 11a (cldn11a), mRNA. (1222 bp)
in-frame stop codon" CDS 420..1073 /gene="cldn11a" /gene_synonym="CLDN11c" /note="claudin 11c" /codon_start=1 /product="claudin-11a" /protein_id="NP_001316218.1" /db_xref="GeneID:108278399" /translation="MASACLQLSGFFLSVLGWICVIISTSTSDWVILCKYSMNTCRKMDELETKGLWEQCVISTALYHCYSLNQILELPVYIQTCRALMISACILGLPAAALLLSSMPCIHLGEDSVNDKNKRSVIGGILMLIVAMFSVVSTVWFPVGAHQELRLMSFGFSLYSGWVGGALSLLGGCILTCCSIDSTPSYHQNNRYSYYSKQNPPTNQTPPTSNHAKTAQV" misc_feature 435..944 /gene="cldn11a" /gene_synonym="CLDN11c" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 646..810 /gene="...
Synonym: CLDN11c
NM_001329289.1 - Ictalurus punctatus (channel catfish) - NCBI
Mus musculus claudin 2 (Cldn2), transcript variant 1, mRNA. (3069 bp)
culus claudin 2 (Cldn2), transcript variant 1, mRNA. ACCESSION NM_016675 VERSION NM_016675.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced NM_016675.4. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_016675.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 5 (Cldn5), mRNA. (1442 bp)
gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" exon 1..1427 /gene="Cldn5" /inference="alignment:Splign:2.1.0" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV" misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_031701.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 1, mRNA. (3794 bp)
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY138805.1, AK128999.1 and AC068663.5. On Aug 14, 2009 this sequence version replaced NM_022890.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
NM_022890.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 14 (Cldn14), transcript variant 3, mRNA. (1456 bp)
start=1 /product="claudin-14" /protein_id="NP_001159398.1" /db_xref="CCDS:CCDS28345.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 552..614 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" misc_feature 597..1073 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_001165926.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a, mRNA. (1200 bp)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_023878.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Orcinus orca claudin 9 (LOC101289236), mRNA. (1600 bp)
to: 35 Proteins" /db_xref="GeneID:101289236" CDS 280..933 /gene="LOC101289236" /codon_start=1 /product="claudin-9" /protein_id="XP_004270317.1" /db_xref="GeneID:101289236" /translation="MASAALELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTGGVILLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAASALLMLGGGLLCCTCPPPQIDRPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 292..795 /gene="LOC101289236" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_004270269.3 - Orcinus orca (killer whale) - NCBI
Mus musculus claudin 14 (Cldn14), transcript variant 2, mRNA. (1283 bp)
start=1 /product="claudin-14" /protein_id="NP_001159397.1" /db_xref="CCDS:CCDS28345.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 362..424 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" misc_feature 407..883 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_001165925.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Pongo abelii claudin domain containing 1 (CLDND1), mRNA. (2234 bp)
in-frame stop codon" CDS 82..912 /gene="CLDND1" /codon_start=1 /product="claudin domain-containing protein 1" /protein_id="NP_001127451.1" /db_xref="GeneID:100174522" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA" misc_feature 199..852 /gene="CLDND1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833" exon...
NM_001133979.1 - Pongo abelii (Sumatran orangutan) - NCBI
PREDICTED: Canis lupus dingo claudin 19 (CLDN19), transcript variant X2, mRNA. (1167 bp)
CLDN19" /note="claudin 19; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:112642257" CDS 360..1034 /gene="CLDN19" /codon_start=1 /product="claudin-19 isoform X2" /protein_id="XP_025275471.1" /db_xref="GeneID:112642257" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALEGGCPGGAAGSCPSPFIPGSYAPASPTARSVPPALPRSHPVSASPDGGGRAPGLCGHGPQCGRHEVHSGWRQQPHRQGPHRHLWGCPLPAGRPLHSDSRFVVCHPGDTGVLQPQHTCQRQVRVRLGPVRGLGIGRPGHAGGLLPLLHVPRA" misc_feature 369..>575 /gene="CLDN19" /note="PMP-22/EMP/MP20/Claudin family; Region:...
XM_025419686.3 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Orcinus orca claudin 24 (LOC101270743), mRNA. (912 bp)
Proteins" /db_xref="GeneID:101270743" CDS 1..663 /gene="LOC101270743" /codon_start=1 /product="putative claudin-24" /protein_id="XP_004281793.1" /db_xref="GeneID:101270743" /translation="MALVFRVAMQFVGILLSLLGWVLSIITTFLPHWKNLNLDLNEMENWTVGLWQTCVTQEEVGMQCKDFDSFLALPAELRISRILMFLSNGLGFLGLLVSGFGLDCLRIGERQQDVKKQLLILGGILFWTAGVTALVPVSWVAHRTVQEFWDETIPEIVPRWEFGEALFIGWFAGFSLLLGGCLLNWAACGTQIPLASGHYAVAEMQTQCSYLENGTANPSV" misc_feature 28..549 /gene="LOC101270743" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833" ORIGIN //...
XM_004281745.3 - Orcinus orca (killer whale) - NCBI
PREDICTED: Orcinus orca claudin 14 (LOC101269602), mRNA. (911 bp)
Proteins" /db_xref="GeneID:101269602" CDS 115..825 /gene="LOC101269602" /codon_start=1 /product="claudin-14" /protein_id="XP_004264597.1" /db_xref="GeneID:101269602" /translation="MASAAVQLMGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQASRALMVISCLLSGVACACAVVGMKCTRCAKGTPAKTTFAVLGGVFFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLACQDEAPSRPYQAQPRAGTATAPSYRPPDAYKDNRAPSATSASHNGYRLNDYV" misc_feature 127..657 /gene="LOC101269602" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833" ORIGIN //...
XM_004264549.3 - Orcinus orca (killer whale) - NCBI
PREDICTED: Orcinus orca claudin 16 (LOC101285286), mRNA. (2989 bp)
Proteins" /db_xref="GeneID:101285286" CDS 467..1174 /gene="LOC101285286" /codon_start=1 /product="claudin-16" /protein_id="XP_004278800.2" /db_xref="GeneID:101285286" /translation="MRDLFQYVACFFAFFSTGFLVVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHSLKLVVTRALMITADILAGFGFIILLLGLDCVKFLPDEPYIKVRICFVAGTTLLIAGAPGIIGSVWYAVDVYVERSSLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYLYSRRKGYSTTAVSMAQSYAAPRTQTAKMYAVDTRV" misc_feature 497..1015 /gene="LOC101285286" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_004278752.3 - Orcinus orca (killer whale) - NCBI
PREDICTED: Canis lupus dingo claudin 11 (CLDN11), transcript variant X1, mRNA. (885 bp)
similarity to: 11 Proteins" /db_xref="GeneID:112645951" CDS 119..742 /gene="CLDN11" /codon_start=1 /product="claudin-11 isoform X1" /protein_id="XP_025281351.1" /db_xref="GeneID:112645951" /translation="MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVMLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVIVCCAGDAQAFGENRFYYSSGSSSPTHAKSAHV" misc_feature 134..634 /gene="CLDN11" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_025425566.3 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Orcinus orca claudin 6 (LOC101288986), transcript variant X1, mRNA. (1846 bp)
mRNAs, 27 Proteins" /db_xref="GeneID:101288986" CDS 562..1227 /gene="LOC101288986" /codon_start=1 /product="claudin-6" /protein_id="XP_004270316.1" /db_xref="GeneID:101288986" /translation="MASAGLQILGIVLTLLGWVNALVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLAGAKCTTCVEDKDSKARLVLISGIIFVISGVLTLIPVCWTAHTIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 574..1071 /gene="LOC101288986" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_004270268.4 - Orcinus orca (killer whale) - NCBI
PREDICTED: Panthera uncia claudin 11 (CLDN11), mRNA. (1916 bp)
ote="claudin 11; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:125921897" CDS 214..837 /gene="CLDN11" /codon_start=1 /product="claudin-11" /protein_id="XP_049485590.1" /db_xref="GeneID:125921897" /translation="MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVMLILLALCAMVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVIVCCAGDAQAFGENRFYYSSGSSSPTHAKSAHV" misc_feature 229..729 /gene="CLDN11" /note="PMP-22/EMP/MP20/Claudin...
XM_049629633.1 - Panthera uncia (snow leopard) - NCBI
PREDICTED: Canis lupus dingo claudin 19 (CLDN19), transcript variant X3, mRNA. (1107 bp)
gene="CLDN19" /note="claudin 19; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:112642257" CDS 413..1015 /gene="CLDN19" /codon_start=1 /product="claudin-19 isoform X3" /protein_id="XP_035555075.1" /db_xref="GeneID:112642257" /translation="MSVPLLLPGCGLERDKLACKPAPLQLCPCPGPRRPDPTSYHTSLLYDTHAGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRIAISGGVLFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGSALFVGWASAGLAMLGGSFLCCTCPEPERAASSPQPYRPGPSAAAREPVVKLSASAKGPLGV" misc_feature <560..886 /gene="CLDN19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
XM_035699182.2 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo claudin 7 (CLDN7), mRNA. (1321 bp)
te="claudin 7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:112647497" CDS 461..1096 /gene="CLDN7" /codon_start=1 /product="claudin-7" /protein_id="XP_025284424.1" /db_xref="GeneID:112647497" /translation="MANSGLQLLGFALALVGWAGLVASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTNCGGDDKVKKARIAMTGGIIFIVGGLAALVACSWYGHQIVTDFYNPLVPMNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGSESKAGYRAPRSYPKPNSAKEYV" misc_feature 470..1006 /gene="CLDN7" /note="PMP-22/EMP/MP20/Claudin...
XM_025428639.2 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo claudin 9 (CLDN9), mRNA. (3402 bp)
similarity to: 21 Proteins" /db_xref="GeneID:112640494" CDS 2234..2887 /gene="CLDN9" /codon_start=1 /product="claudin-9" /protein_id="XP_025272578.1" /db_xref="GeneID:112640494" /translation="MASTALELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGLLVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPPQMDRPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 2243..2722 /gene="CLDN9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" polyA_site 3402 /gene="CLDN9" /experiment="COORDINATES:...
XM_025416793.3 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo claudin 1 (CLDN1), mRNA. (3395 bp)
to: 8 long SRA reads, 20 Proteins" /db_xref="GeneID:112645827" CDS 257..892 /gene="CLDN1" /codon_start=1 /product="claudin-1" /protein_id="XP_025281134.1" /db_xref="GeneID:112645827" /translation="MANAGLQLLGFLLAFLGWVGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATIGMKCMKCMEDDEVQKMRMAVIGGVIFLIAGLAVLVATAWYGNRIVQDFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV" misc_feature 308..775 /gene="CLDN1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" polyA_site 3395 /gene="CLDN1" /experiment="COORDINATES: polyA...
XM_025425349.3 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo claudin 8 (CLDN8), mRNA. (2270 bp)
similarity to: 10 Proteins" /db_xref="GeneID:112661796" CDS 339..1016 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="XP_025305705.1" /db_xref="GeneID:112661796" /translation="MATYALQIAGLVLGGFGMVGTLAVTIMPQWRVSAFIGSNIVVFENFWEGLWMNCVRQANIRMQCKVYDSLLALSPDLQASRGLMCAASVLSFLAFMTAVLGMKCTRCTGDDEKIKGHILLTAGIIFIVTGILVLIPVSWVANSIIREFYNPIVETAQKHELGDALYIGWTTALVLIAGGALFCCVSCYSEKSRSYRYSIPSHRTAQKSYHMEKKSPSVYSRSQYV" misc_feature 351..884 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" polyA_site 2270 /gene="CLDN8" /experiment="...
XM_025449920.3 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo claudin 4 (CLDN4), mRNA. (3448 bp)
to: 24 long SRA reads, 10 Proteins" /db_xref="GeneID:112646147" CDS 2009..2641 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="XP_025281589.1" /db_xref="GeneID:112646147" /translation="MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALMVVSIILAALGVLLSVVGGKCTNCVEDESAKAKTMIVAGVVFLLAGLLVMVPASWTANNIIRDFYNPLVVSGQKREMGASLYVGWAASGLLLLGGALLCCNCPPRADKPYSAKYSAAARSAPASNYV" misc_feature 2018..2512 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" polyA_site 3448 /gene="CLDN4" /experiment="COORDINATES:...
XM_025425804.3 - Canis lupus dingo (dingo) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/en/claudin
lang : en | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.099 | 0.099 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.205 | 0.105 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.211 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]