GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2021-12-06 05:27:47, GGRNA : RefSeq release 208 (Sep, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Biomphalaria glabrata clumping factor A-like (LOC106075409), partial mRNA. (812 bp)
db_xref="GeneID:106075409" CDS <1..812 /gene="LOC106075409" /codon_start=3 /product="clumping factor A-like" /protein_id="XP_013091805.1" /db_xref="GeneID:106075409" /translation="QGHSENKDHSKNKDHSKNKDHSKNKDHSKNKGHSKNKDHSKNKDHSKNKDHSKNKDHSKNKDHNKNKDHSKNKGHSKNKDHSKNKDHRKNKDHRKNKDHSIEADIKTDIETDIKTDNETDIETDIKTDIETDIKTDIETDIETGIKADIKTDIETGIETGIKTDIETDIETDNETDIETDIETDIETDIETDIETDNETDIETGIETDIETDIETDIEIDIKTDIKTDIETDIKTDIKTDIETDIETDIKTDIETDIETDIETDIEIDI" misc_feature <141..800 /gene="LOC106075409" /note="Ring-infected erythrocyte surface antigen; Provisional; Region: PTZ00341" /db_xref="CDD:173534"...
AA_position 109
XM_013236351.1 - Biomphalaria glabrata - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X4, mRNA. (2182 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETDKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFP...
AA_position 301
XM_031791523.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X20, mRNA. (2119 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_...
AA_position 301
XM_031791539.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X19, mRNA. (2118 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREKFRKDNDKLKIETDKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_...
AA_position 301
XM_031791538.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X18, mRNA. (2118 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_...
AA_position 301
XM_031791537.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X11, mRNA. (2162 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETL...
AA_position 301
XM_031791530.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X10, mRNA. (2161 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETL...
AA_position 301
XM_031791529.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X8, mRNA. (2160 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETL...
AA_position 301
XM_031791527.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X2, mRNA. (2204 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEG...
AA_position 301
XM_031791521.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X1, mRNA. (2204 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEG...
AA_position 301
XM_031791520.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X22, mRNA. (2097 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_feature...
AA_position 301
XM_031791541.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X21, mRNA. (2097 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_feature...
AA_position 301
XM_031791540.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X16, mRNA. (2139 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETEELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG"...
AA_position 301
XM_031791535.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X15, mRNA. (2139 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG"...
AA_position 301
XM_031791534.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X14, mRNA. (2139 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG"...
AA_position 301
XM_031791533.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X13, mRNA. (2139 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG"...
AA_position 301
XM_031791532.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X12, mRNA. (2139 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG"...
AA_position 301
XM_031791531.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X7, mRNA. (2183 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETEELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFP...
AA_position 301
XM_031791526.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X6, mRNA. (2183 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFP...
AA_position 301
XM_031791525.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X5, mRNA. (2183 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETEELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFP...
AA_position 301
XM_031791524.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X3, mRNA. (2181 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFP...
AA_position 301
XM_031791522.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X26, mRNA. (2034 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREKFRKDNDKLKIETDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_feature 334..636 /gene="...
AA_position 301
XM_031791545.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X23, mRNA. (2076 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_feature 334..636 /...
AA_position 301
XM_031791542.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X17, mRNA. (2118 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_...
AA_position 301
XM_031791536.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X9, mRNA. (2161 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREKFRKDNDKLKIETVELREENNKLKIETDNVKMEREELREENNNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETL...
AA_position 301
XM_031791528.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X27, mRNA. (2012 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_feature 333..635 /gene="LOC109886139" /...
AA_position 301
XM_031791546.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X24, mRNA. (2055 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_feature 334..636 /gene="...
AA_position 301
XM_031791543.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X28, mRNA. (1991 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_feature 333..635 /gene="LOC109886139" /note="...
AA_position 301
XM_031791547.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Oncorhynchus kisutch butyrophilin subfamily 3 member A2-like (LOC109886139), transcript variant X25, mRNA. (2033 bp)
TFPTSAVWCFGILFISASLITTGSSEVQVVGPADRVDALAGDDIILPCSLKPNISAKDMLVQWTGLYLKTRNVHLYRQGRDSNEDQFPSYRGRTSMFHEELKNGNVSLKLTRVTLSDAGSYRCFLPTLTSQVKETTVQLFVGAVSQPVISIVGTKDWGVVLKCESGGWFPEPEMEWLDSSGTILPADGPPERHRDSEDLYALRRHVTVDQTDTNRFTCRVHQTEINHLKETEIHVPDDVFPKSHVGLIIGLSILLAVVVLAASAGVYKWRKHTDKVTRERDGLKGELMELREENNKLKIETDNVKMEREKFRKDNDNVKMEREELREENNNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDKLKIETDNVKMEREKFRKDNDNVKMEREKFRKDNDKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENNKLKIETDNVKMEREELREENKKLKKDKGKLKRPSNPIQSPPLQEVNRKQTPSQKSEGIEGMKLESFPAPEMETLPEG" misc_feature 333..635 /gene="...
AA_position 301
XM_031791544.1 - Oncorhynchus kisutch (coho salmon) - NCBI
PREDICTED: Prunus persica dr1-associated corepressor (LOC18789907), mRNA. (1488 bp)
db_xref="GeneID:18789907" /translation="MAEEQNAAREEENAEQREENAEQAEENAEQEEENAEQADENAEQEEDDAEQEEDNSEKAVENAAVKEKAKVAQEEENAEPIRSENSQIRPEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEVATEKKRKIVKLEHMRVAVKRHRPTSDFLLDELPVPSQPSDHQPTDRSSSRTVSHAPAPARRDRSRSRAVSYKPAPAGTRRIDHFFRTKEIPIQTEQSLIETEEAPIETEEASIEIDEAPIETDEGPIETDEASIETDEASIETDEASIETDEAPIVTDEGPIETGEGPIETNES" misc_feature 546..737 /gene="LOC18789907" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:279185" ORIGIN //...
AA_position 256
XM_007227173.2 - Prunus persica (peach) - NCBI
Galdieria sulphuraria hypothetical protein (Gasu_26660) mRNA, complete cds. (2170 bp)
hypothetical protein" /protein_id="XP_005706398.1" /db_xref="GeneID:17088646" /translation="MKLLQSFCLLSLCIIFCLSPLLAEAADYERLCHCFQQDTSAFDLYKLVGTYSVTSCSSCNEKNCAALFGEQESDYNKLCAYIGESVVDAVESVLEGDFKSAETYMQDLISNQTTLIENYIDKLLGYLNNTLDGFRNEVGTNITVIEQEINEINTTFIAQDIQEAVTQIENYVSKDINEAITSLEVQIQKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNLTLVLDEIKKYAEKIEVNISEQLDIIETDIEQVNITLVLDEIKKYAEKIEVNVTSDIDQAINTLKEFVDSVSVDVEANISLDINKAVKTLQ...
AA_position 205
XM_005706341.1 - Galdieria sulphuraria - NCBI
PREDICTED: Prunus dulcis dr1-associated corepressor (LOC117615337), mRNA. (1176 bp)
id="XP_034200295.1" /db_xref="GeneID:117615337" /translation="MAEEQNVAREEDNIAGEEKAEQAEENAEQAEENAEQEEDDPEKAVENAAVKEKAKVAQEEENAEPIRSENSQIRPEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEVATEKKRKIVKLEHMRVAVKRHRPTSDFLLDELPVPSQPSDHQPTDRSSSRTVSHAPAPARRDRNRSRAVSDKPAPAGTRRIDHFFRTKEIPIQTEQSLIETEEASIEIDEAPIETDEGPIETDEASIETDEASIETDEGPIETGEGPIETNES" misc_feature 293..487 /gene="LOC117615337" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:395650" ORIGIN //...
AA_position 234
XM_034344404.1 - Prunus dulcis (almond) - NCBI
PREDICTED: Camponotus floridanus flocculation protein FLO11 (LOC105255116), transcript variant X3, mRNA. (2073 bp)
by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:105255116" CDS 105..1439 /gene="LOC105255116" /codon_start=1 /product="flocculation protein FLO11" /protein_id="XP_025263993.1" /db_xref="GeneID:105255116" /translation="MNMTKHPLYETSTDSTENIITSTSIETDSTEDITTSTSIETDSTEDITTSTSIETDSTEDITSTSIETDSTEHITTSTSIETDSTEDTNDTKSSASTNSTDDDDTASFTFINFHPHISDVTSADNQAETLKVEFEELRRNDDNLHKFTEMAIFRNHYMFPTVPNTVLSKQKNTLKSVLNQKSSKTNEDIAISTKQKLEKKDHISKNKHCKKPQSLVLWRPLAPPIQDLEEKSRIYKLLMKHVFTRESRLIFNYKRERRSSLPFTPIPKLLAICPPPPESTTSELLNVIEKPNTSKSDINLDSQSSKTCIFTKQAKIKTPKDSTNESNSSTDD...
AA_position 25
XM_025408208.1 - Camponotus floridanus (Florida carpenter ant) - NCBI
PREDICTED: Camponotus floridanus flocculation protein FLO11 (LOC105255116), transcript variant X2, mRNA. (2083 bp)
by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:105255116" CDS 115..1449 /gene="LOC105255116" /codon_start=1 /product="flocculation protein FLO11" /protein_id="XP_025263992.1" /db_xref="GeneID:105255116" /translation="MNMTKHPLYETSTDSTENIITSTSIETDSTEDITTSTSIETDSTEDITTSTSIETDSTEDITSTSIETDSTEHITTSTSIETDSTEDTNDTKSSASTNSTDDDDTASFTFINFHPHISDVTSADNQAETLKVEFEELRRNDDNLHKFTEMAIFRNHYMFPTVPNTVLSKQKNTLKSVLNQKSSKTNEDIAISTKQKLEKKDHISKNKHCKKPQSLVLWRPLAPPIQDLEEKSRIYKLLMKHVFTRESRLIFNYKRERRSSLPFTPIPKLLAICPPPPESTTSELLNVIEKPNTSKSDINLDSQSSKTCIFTKQAKIKTPKDSTNESNSSTD...
AA_position 25
XM_025408207.1 - Camponotus floridanus (Florida carpenter ant) - NCBI
PREDICTED: Camponotus floridanus flocculation protein FLO11 (LOC105255116), transcript variant X1, mRNA. (2284 bp)
by RNAseq alignments, including 5 samples with support for all annotated introns" /db_xref="GeneID:105255116" CDS 316..1650 /gene="LOC105255116" /codon_start=1 /product="flocculation protein FLO11" /protein_id="XP_011262511.3" /db_xref="GeneID:105255116" /translation="MNMTKHPLYETSTDSTENIITSTSIETDSTEDITTSTSIETDSTEDITTSTSIETDSTEDITSTSIETDSTEHITTSTSIETDSTEDTNDTKSSASTNSTDDDDTASFTFINFHPHISDVTSADNQAETLKVEFEELRRNDDNLHKFTEMAIFRNHYMFPTVPNTVLSKQKNTLKSVLNQKSSKTNEDIAISTKQKLEKKDHISKNKHCKKPQSLVLWRPLAPPIQDLEEKSRIYKLLMKHVFTRESRLIFNYKRERRSSLPFTPIPKLLAICPPPPESTTSELLNVIEKPNTSKSDINLDSQSSKTCIFTKQAKIKTPKDSTNESNSSTD...
AA_position 25
XM_011264209.3 - Camponotus floridanus (Florida carpenter ant) - NCBI
Malassezia globosa CBS 7966 hypothetical protein MGL_3332 partial mRNA. (2646 bp)
RSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSKTTPKPPTPNSSPKKSCQTVPSVMASTTKVVDSNGRTHTSATTFTTMVLESSCRSRTSPRKPHETAAMPHSHRTSSCKTETSVVTSMTTSVDSRGETHTRATTMTTMVPESSCRSMTTPKQTKSCSSMTSVIETDVISTDSKGRKHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISTDSKGRKHTSSTVKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPHTTKRSTVKPSKKSTTSCSSMTSVIETDVISVDSKGSTHTSSTKKTTVVPASSCVSTTPTSTTRSTVKPSKKSTTSCSSMTSAIETDIIS...
AA_position 362
XM_001729736.1 - Malassezia globosa CBS 7966 - NCBI
PREDICTED: Juglans microcarpa x Juglans regia uncharacterized LOC121247318 (LOC121247318), mRNA. (696 bp)
gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:121247318" CDS 1..696 /gene="LOC121247318" /codon_start=1 /product="uncharacterized protein LOC121247318" /protein_id="XP_041001620.1" /db_xref="GeneID:121247318" /translation="MTIDRQVVAPTPEDVIETDEAKKNQSGKQVSQPEMTIDRQVVAPTPEDVIETDEAKKNQSGKQVSQPEMTIDRQVVAPTPEDVIETDEAKKNQRKLNVKKKAFLTEQVSALVLSETPQKLGDPGSPNISIIIGESGIERALLDLGSSVNLLPFSVNEELGLGELKKTSIMLQLVDRSVKVPRGIVEDVLVQATSTIYQALVILGSPFLAMSNALINCRSGVLTLTSGKHGT" ORIGIN //...
AA_position 16
XM_041145686.1 - Juglans microcarpa x Juglans regia - NCBI
PREDICTED: Spodoptera frugiperda actin cytoskeleton-regulatory complex protein PAN1-like (LOC118270005), mRNA. (1660 bp)
introns" /db_xref="GeneID:118270005" CDS 90..833 /gene="LOC118270005" /codon_start=1 /product="actin cytoskeleton-regulatory complex protein PAN1-like" /protein_id="XP_035441313.1" /db_xref="GeneID:118270005" /translation="MKSLLIVASVIALAVAGPTHRGLVAPGPAGPAPAPEAEYVPIAVGPAILDFEPIAVGPAVVDSHPISVGPAIIETDPISVGPAIIETHPISVGPAIIDSHPISVGPAIIETDPISVGPAIIETDPISVGPAIIDAEPIAVGPVFVEEPVAVEPVHVVEEAAPAPAPSNPLVQIILNINGVSHVIDAPTSLPAEDIVPSPVHVVEAAPEPVQVIESAPEPVHVVDIAPVEIGTPVLPTPQVVEPVEEH" misc_feature <369..830 /gene="LOC118270005" /note="ribonuclease E; Reviewed; Region: rne; PRK10811" /db_xref="CDD:236766" ORIGIN...
AA_position 73
XM_035585420.1 - Spodoptera frugiperda (fall armyworm) - NCBI
PREDICTED: Spodoptera frugiperda KH domain-containing protein 3-like (LOC118278256), mRNA. (966 bp)
annotated introns" /db_xref="GeneID:118278256" CDS 87..866 /gene="LOC118278256" /codon_start=1 /product="KH domain-containing protein 3-like" /protein_id="XP_035453303.1" /db_xref="GeneID:118278256" /translation="MKSLLIVASVIALAIAGPAHRGLVAPGPAGPAPAPEAEYVPIAVGPAILDFEPIAVGPAVVDSHPISVGPAIIETHPISVGPAIIETDPISVGPAIIETHPISVGPAIIETDPISVGPAIIETDPISVGPAIIETHPISVGPAIIDAEPIAVGPAFIEEPVAVEPVHVVEEAAPAPAPSTPLVQIILNINGVSHVIDAPTSVPAEAIVPSPVHVVEAAPEPVQVIESAPEPVHVVDIAPVEIGTPVLPTPQVVEPVEEH" misc_feature <273..863 /gene="LOC118278256" /note="ribonuclease E; Reviewed; Region: rne; PRK10811" /db_xref="CDD:236766"...
AA_position 85
XM_035597410.1 - Spodoptera frugiperda (fall armyworm) - NCBI
PREDICTED: Anguilla anguilla zona pellucida glycoprotein 3d tandem duplicate 2 (zp3d.2), mRNA. (2109 bp)
YNVSQCGSNTTMINNRVVYSNTLHFTPEAPKSLIRTAVPFSLPIFCHYNRFHYSYKIGYLPEIKTHQFFKSMQPSSDFTLSACNARWERLPAARGYVIGSPMYFEARSPPVSRDQRLFVSFCYATPSRELAGALRFAVIENSGCMSHNNGAGSRSRFVRHKRDVLRFEVEAFVFEGVADERLYMHCEMFVANHFATEIAKSCTYNSTTGRWEELYGDTQVCTCCNSTCISSASAAELPATKKIVTSGSWVLEPDSGAVLGEATVEWDKPPRPETKSVTEALAIVTEPEIRRWTEPETTIETDPEIMRWTEPETTIETDSEIMRWPEPETTIETDSEIMRWPEPETTIETDSEIMRWPEPETTIETDSEILRWTEPETTMVTEPEIRRLTEPKATMVTETEIRRLTEPKATMVTEPEIRRWTQPKATMVTEPVTPPEVKRWPDKVPKGKPVKGSAVKEAEKGSVPRLSFKEVFGIP" misc_feature 258..992 /gene="zp3d.2" /note="Zona pellucida-like domain; Region: Zona_pellucida; pfam00100" /db_xref="CDD...
AA_position 396
XM_035385074.1 - Anguilla anguilla (European eel) - NCBI
PREDICTED: Hyalella azteca cornifin-B-like (LOC108679632), mRNA. (384 bp)
analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108679632" CDS 1..384 /gene="LOC108679632" /codon_start=1 /product="cornifin-B-like" /protein_id="XP_018023778.1" /db_xref="GeneID:108679632" /translation="MAAFRVNAPGYPPAIETDYPPAIETDYPPATEPAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETAHPPATETDYSPATETDYPTATETDYPPATGTGQISIAVYTLQRTC" misc_feature 49..>309 /gene="LOC108679632" /note="multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue...
AA_position 15
XM_018168289.1 - Hyalella azteca - NCBI
PREDICTED: Styela clava uncharacterized LOC120326617 (LOC120326617), mRNA. (429 bp)
GeneID:120326617" CDS 1..429 /gene="LOC120326617" /codon_start=1 /product="uncharacterized protein LOC120326617" /protein_id="XP_039248875.1" /db_xref="GeneID:120326617" /translation="MNAALVAVEAQGALGMNDHQMHLYCTNRDQRSIQTDQRIMQGKAGPRGPRGPPGEVDYHIINETINEYFTDTSGQIQANLTQIGPIVAKSSEDIEGLQEASRNTQTKLNVIETDIESASGHTRIKLNEIETDIEGLKSGKKE" ORIGIN //...
AA_position 111
XM_039392941.1 - Styela clava - NCBI
PREDICTED: Gigantopelta aegis uncharacterized LOC121390367 (LOC121390367), mRNA. (936 bp)
uncharacterized protein LOC121390367" /protein_id="XP_041378097.1" /db_xref="GeneID:121390367" /translation="MLSSLCDQMVSSLCDQVSGLSHCGITLHKPTVAANPSASCTDLINQQVAQSSVKNASSCTVTTETDVDQSESCIDNANSGKVSTETDVDQSESCIDNANSGTVTTETDVDQSESCIDNANSGKVSTETDVDQSESCIDNANSGKVSTETDVDQSESCIDNANSGTVSTETDVELSESCIDNANSGTVSIETDVDQSESCIDNANSRKVSIETDVELSESCIDNANNGTVSIETDIEQSESCIDNAKNGTDSPSEYLRNKITVELTEAKHSKYFSVIADEVTDTTTNKEVLSVCLRFLVGGEPEEAEIADVS" ORIGIN //...
AA_position 189
XM_041522163.1 - Gigantopelta aegis - NCBI
PREDICTED: Lingula anatina uncharacterized LOC106157898 (LOC106157898), mRNA. (1046 bp)
GeneID:106157898" CDS 72..1046 /gene="LOC106157898" /codon_start=1 /product="uncharacterized protein LOC106157898" /protein_id="XP_013389147.2" /db_xref="GeneID:106157898" /translation="MKVVIAVIFLAGAVLGQQSREERCQLLEEKGCQDRWKVNNLRICGSDKQMYTSWCAFITAQCADDDLKMDRNIRHCLQGQLNVLSNVTRLPPPTRPPRPTRPSVDICQKIETDGCSDRMNRPTRLCASNGKMYTTGCDFFKARCEDATLKIDRNIRHCQSQVNVLSNVTRLPPPTRPPRPTRPSVDICQKIETDGCSDRMNRPIRLCASNGKMYTTSCDFTKARCEDPALRVDWNIRHCQSQVNVLSNVTRLPPPTRPPRPTRPSVDICQKIETDGCSDRLNRPTRLCASNGKMYTTGCDFVKARCEEPSLKLDRNLNHCRQDE" ORIGIN //...
AA_position 110
XM_013533693.2 - Lingula anatina - NCBI
PREDICTED: Prunus avium retrotransposon-like protein 1 (LOC110769621), mRNA. (1268 bp)
translation="MAEEQNAAREEDNIAPEENAEQGEENAEQEEENAEQEEENAEQEEENAEQGEEKAEQEEEDAEKAEENAEQEEDDAEQEEDNAEQEEDNPEKAVEKAAVKEKAKVAQEEENAEPIRSENSQIRAEFPNTRVKRIMKLDRGINKVNSEALLLVSCSAQLFLEFLAERSAEIAMEKKRKIVKLEHMRVAVKRHRPTSDFLLDELPVPSQPSDHQPTDRSGSRTVSHAPAPAREDRRRSSAVSDKPAPAGTRRIDHFFRAKEIPIQTEKSLIETDEASIEIDEAPIETDEGPIETDEAASIEMDEAPIVTDEGPIETGEGSIETNKS" misc_feature 373..564 /gene="LOC110769621" /note="Histone-like transcription factor (CBF/NF-Y) and archaeal histone; Region: CBFD_NFYB_HMF; pfam00808" /db_xref="CDD:279185" ORIGIN //...
AA_position 269
XM_021973644.1 - Prunus avium (sweet cherry) - NCBI
PREDICTED: Styela clava caspase-3-like (LOC120332051), mRNA. (540 bp)
evidence includes similarity to: 16 Proteins" /db_xref="GeneID:120332051" CDS 1..540 /gene="LOC120332051" /codon_start=1 /product="caspase-3-like" /protein_id="XP_039255187.1" /db_xref="GeneID:120332051" /translation="MTHGNLLKDESKKQEIEVIYGKNGGTDYIERKEIDNMFQNDVAVDLQGIPKFFIYQCCRGKIHMKAINSQIETDDIETDCSDREDAVPIISDIVIINSTLPGHMAYKDGEGSILITSINTIFGKHGKKKHVLDLLTMVNSEMLKYISSCRQSPQSLETIFIKPMSVLESCLVKHFYLTE" misc_feature <1..462 /gene="LOC120332051" /note="Caspase domain; Region: Peptidase_C14; pfam00656" /db_xref="CDD:395530" misc_feature order(7..9,172..174) /gene="LOC120332051" /note="active site" /db_...
AA_position 71
XM_039399253.1 - Styela clava - NCBI
PREDICTED: Dendroctonus ponderosae uncharacterized LOC109536759 (LOC109536759), mRNA. (613 bp)
db_xref="GeneID:109536759" CDS 44..553 /gene="LOC109536759" /codon_start=1 /product="uncharacterized protein LOC109536759" /protein_id="XP_019758675.1" /db_xref="GeneID:109536759" /translation="MKFVAVFVVAFVAYASASIISGDRRPIFTNEVESEQVEGSNLPAEIESDNIEISNLPAEIESDNIEISNLPAEIESDNIEISNLPAEIESDNIEISNLPAEIETDEIEISNLPAEIETDKIEISNLPAEIETEDKPQLDGLRPDVETLSVCDLCFSQIATLVEELQRAL" misc_feature <128..550 /gene="LOC109536759" /note="RecF/RecN/SMC N terminal domain; Region: SMC_N; cl25732" /db_xref="CDD:330553" ORIGIN //...
AA_position 102
XM_019903116.1 - Dendroctonus ponderosae (mountain pine beetle) - NCBI
Verruconis gallopava hypothetical protein mRNA. (1369 bp)
locus_tag="PV09_09831" /codon_start=1 /product="hypothetical protein" /protein_id="XP_016208194.1" /db_xref="GeneID:27317804" /translation="MKGLIGCLEADDMDKMMTALSEARADEVLQNDTESTVQTLVLSQEAEGPTLRMQVLDALQSLAQIHIMHEMMVLKLQTEVGVGNSRTLTLETFKTNQNNMNERISFLIGSLEADDMDKMRTALEEADAVRTAVNENITKTATLLQESLIETDNDKAKEVPKIETDSGIEVEPASQIKEE" ORIGIN // REFERENCE 1 (bases 1 to 1369) AUTHORS Cuomo,C., de Hoog,S., Gorbushina,A., Stielow,B., Teixiera,M., Abouelleil,A., Chapman,S.B., Priest,M., Young,S.K., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE The Genome Sequence of...
AA_position 149
XM_016363977.1 - Verruconis gallopava - NCBI
PREDICTED: Anneissia japonica mucin-3A-like (LOC117101896), mRNA. (4485 bp)
gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:117101896" CDS 1..4485 /gene="LOC117101896" /codon_start=1 /product="mucin-3A-like" /protein_id="XP_033097903.1" /db_xref="GeneID:117101896" /translation="MRTSEISRQPTGCILKSIIICLFLPLYLASTEQTGTARIETDYATNADVSSTNSASTTQPRFISKSNTIIYDHNNTTSPDTTRIETDYTTNADVSFVTTITENVTTTGKILFFTDITTFKQTIKKNNKITSDEVVTTSITGVTSNKEEPTIVELIFGTTELPTIPSTHNIKTPALTNDTNTKDSGTGTDYTTDADVSSTYSAITTQPRFISTMNTIINKHNTTTSPDTTRIETDYTTNADISSTYSAIATQPRFTSTTDTYSETDYTTDADVSSTYSDINTQSRFISTTNTIISEHNTTTLPDTTTIEIDYTTNADVSSTHSAIATQPRYTSTTDTYTETD...
AA_position 39
XM_033242012.1 - Anneissia japonica - NCBI
PREDICTED: Plutella xylostella probable GPI-anchored adhesin-like protein PGA55 (LOC105397220), mRNA. (1840 bp)
db_xref="GeneID:105397220" /translation="MDPSIIFPSHLFDQSFGLCITPQDLILPTNNIINPNYHRPWKWYIENVSKDSGSTIESDKNKFQVTLDMQHFKPDEISVTVINKEIIIEGKHGERLDDHGVVSRQFLRRYALPVDCDSDDFTANLSSDGILMVCAKKKMIQNLTNERQVHIQLCDSLLTKEVKSNLSSKTSDEEMNKSQIKKQDEKCDINIKCEKSKQEAEEKSNMKSSSLDDSRHSKNSQLMLREEHSRLLKPEFLGETLSNVGGTIIKESKIETDELLEMSSSRAGKANVEGTTKETKKIESDEHLEMSSSRIGGTITGAKIETDELLEMSSSRFGKGNVGGTIKKAKIETDELLEMSSSRIGGTITGAKTETDELLEMSSSRFGKGNVGGTIKKAKIETDELLEMSSSRIGGTITGAKTETDELLEMTSSRFGKGNIGEIIKEAKIEADELLEMSSSRVAKAMDSISAISDEMLNMAIGNAYQSSMMATEESSTISSEKMSSGSMALSEESMKVVSETGQSSMETKSEKASFSSSSMSSEVVSSQESSSLMSSMSSSVKASSEIATSELLSDRISA...
AA_position 254
XM_011569231.2 - Plutella xylostella (diamondback moth) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/aa%3aIETD
lang : en | div : | spe : | query_string : aa:IETD | format : html | download :

0.000 | 0.000 | search_start;
0.153 | 0.153 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=(aa:IETD)?to=0&format=json
0.249 | 0.096 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=(aa:IETD)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.256 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]