GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2021-12-06 11:05:54, GGRNA : RefSeq release 208 (Sep, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Camellia sinensis uncharacterized LOC114289714 (LOC114289714), ncRNA. (1872 bp)
gatcaaattccctagcttctgggagtaaactcttccccaacttgatctcttgaatttctttcctcaacttcatctcccaaaatgttttccgatcctcactcaaatctgggtgcataagttcgaaattcgatttcttcatagcctcgttttgcttctccagttccgaaatctgattcgccagcccaatctcttcttgcgatgtctccatttgcttttcagatataaatctcttagtcgtagagacaagacagatagcttactcgcttcactacactaatggcctatgtcagcgttggtcctgctgctcaggttagggttgtagtgtagtgcagtgaagtgagtaagctatctgtcttgtctctacgactaggagatttatatctgaaaaacaaatggagatatcgcaagaagagattgggctggcaaatcagatttcagaactggagaagcaaaacgaggctatgaagaaatcgaatttcgaatttatgcgtccagatttgagtgaggattagaaaacattttgggagatgaagttgaggaaggaaattcaagagatgaagttggggaagagtttactcccagaagctagggaatttgatc...
position 920 1141
XR_003638702.1 - Camellia sinensis - NCBI
PREDICTED: Citrus clementina protein STRICTOSIDINE SYNTHASE-LIKE 4 (LOC18050416), mRNA. (1112 bp)
agtgatttcaagctcatggctccgaagagtttcctgctagcttgtttacttgcttttactctacaattcttcttctcgcctccagtatcatcttcagcttctcttctttccacctccaaggaaagctcctctatgaaggatttgattaaacttggagaaggatgtgtgagccacccagaggatgtttctgttgtggttagaaagggtgcgctgtatacagctactaatgatggttgggtcaagtatttcatcctccataatgaaaccttggttaattggaagcacatagacagtcaatctcttcttggactcacagcaacaaaggaaggtgacgtcattatatgcgacagtaaaaaaggtttgtttaaggttaccgaagaaggcgtaaaggttcttgatccagatgtaagatttgcaaatgatgtgatcgatgcatcagatggcacgttgtattttactgtctcaagcaccaaatatacccccgcagatttctacaaagacatggctgagggaaatccttacggccagttgctcaaatatgatcctaaatcgaaccaaacaacagttttgcaagagggattttactttgctaatggcatt...
position 298
XM_006445687.2 - Citrus clementina - NCBI
PREDICTED: Camelus ferus uncharacterized LOC116657067 (LOC116657067), ncRNA. (330 bp)
gene="LOC116657067" /product="uncharacterized LOC116657067" /db_xref="GeneID:116657067" ORIGIN // accacatcacaaacaaaagtcctaataaaagtcgctgactaggactatcctcgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtacacatgaaagagatgtatttgctcagggtctatcaatcttgttctgcctgttttctcaagtcagcagccttatctttacatttactccactcaatctcttcttgtcattttccctttctgtctgaaaataactacccccaagtctgcaaagcatcatctttgtattccatttcttgttgtaaagagtttgtgacattctgcgagatggacatgctagatcggaagagca
position 193
XR_004311999.1 - Camelus ferus (Wild Bactrian camel) - NCBI
PREDICTED: Rousettus aegyptiacus uncharacterized LOC107512815 (LOC107512815), transcript variant X2, ncRNA. (319 bp)
GeneID:107512815" ncRNA 1..319 /ncRNA_class="lncRNA" /gene="LOC107512815" /product="uncharacterized LOC107512815, transcript variant X2" /db_xref="GeneID:107512815" ORIGIN // cgtcagccggcgctgaactgtgacggcagcgctcacggacccgcggctcgtgacggcattattgggggcgaccatcgacctggatattttttctgcatatgaaaccccgactgacaatctcttcttgcgacgctcgacggtgaagcgccctgttcttccagcagccacggcctctcatgagaagctgctgtcatttaagtgacaacctgcttacagcaaaacgacgccagacgccgttggtttgtgaacggccctcaccacgcggtggacgacgccccgcagaccggcgcccaaaccctgggagcctgcgaagacctcg
position 115
XR_001597394.2 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Citrus sinensis protein STRICTOSIDINE SYNTHASE-LIKE 4-like (LOC102608831), mRNA. (1341 bp)
agtgatttcaagctcatggctccgaagagtttcctgctagcttgtttacttgcttttactctacaattcttcttctcgcctccagtatcatcttcagcttctcttctttccacctccaaggaaagctcctctatgaaggatttgattaaacttggagaaggatgtgtgagccacccagaggatgtttctgttgtggttagaaagggtgcgctgtatacagctactaatgatggttgggtcaagtatttcatcctccataatgaaaccttggttaattggaagcacatagacagtcaatctcttcttggactcacagcaacaaaggaaggtgacgtcattatatgcgacagtaaaaaaggtttgtttaaggttaccgaagaaggcgtaaaggttcttgatccagatgtaagatttgcaaatgatgtgatcgatgcatcagatggcacgttgtattttactgtctcaagcaccaaatatacccccgcagatttctacaaagacatggctgagggaaatccttacggccagttgctcaaatatgatcctaaatcgaaccaaacaacagttttgcaagagggattttactttgctaatggcatt...
position 312
XM_006485118.3 - Citrus sinensis (sweet orange) - NCBI
PREDICTED: Lontra canadensis late cornified envelope protein 1A-like (LOC116858788), mRNA. (414 bp)
ORIGIN // atggggcccaaggtccaaaacaggagctatgaggccttccaggtggcacttgccaaagagaatgaggcagaaaatcaaacttccgactccatcagcgagatgtcctaccagcagaatcagcagcagtgccagtcccctcccaagtgtcccaccccgaagtgccctccaaagtgtcccccaaagtgcccctcaatctcttcttgctgcagtgtcagctctgggggctgctgcagctccagctccgggggtagaagctgctgcagttttggaggtggcagctcctgcctgagccaccacagacgacacaggtcccactgtcacagatgccagagctctggctgctgcagccagccctcagggggctccagctgctgtggagggggcagcagtcagtcctctggaggctgttgctga
position 191
XM_032843692.1 - Lontra canadensis (Northern American river otter) - NCBI
PREDICTED: Cygnus olor uncharacterized LOC121066939 (LOC121066939), ncRNA. (369 bp)
LOC121066939" /db_xref="GeneID:121066939" ORIGIN // agacacacctgatgatttattattttcagtagcttatttgtgaatatgaaaaaatgtctttcttgatattcaccaaatgatataaatgcctttactctccagctcttcattttttctgctcactggtgctttgaatgcagtggaaaggcatttctggtctccatggcttctcttaaatgcacgcagagaagggaacataatagagatgatgagccctagcaaattagccaactgcaatctcttcttgttcagttaacgcgcctgtacagccagataccagccacgggagcaaagggctgtgagaggagatttggagcccaagtataggagtagagaagctctcagctgtttgtagcatgtctagaagca
position 235
XR_005818030.1 - Cygnus olor (mute swan) - NCBI
PREDICTED: Rousettus aegyptiacus uncharacterized LOC107512815 (LOC107512815), transcript variant X1, ncRNA. (409 bp)
GeneID:107512815" ncRNA 1..409 /ncRNA_class="lncRNA" /gene="LOC107512815" /product="uncharacterized LOC107512815, transcript variant X1" /db_xref="GeneID:107512815" ORIGIN // cgtcagccggcgctgaactgtgacggcagcgctcacggacccgcggctcgtgacggcattattgggggcgaccatcgacctggatattttttctgcatatgaaaccccgactgacaatctcttcttgcgacgctcgacggtgaagcgccctgttcttccagcagccacggcctctcatgagaagctgctgtcatttaagtgacaacctgcttacaggaaacctctccatgaaagaagaagaaaacaggtttttatcgaataagcagtaaaccagaacgtgacgtgcatccaggcaatccagtgggacatctcacctggacagagccagactggtgcgacctgtcacacacacgttctcgggatgagcaccagcttgtcttcaggtaagaggacttgacggcaccattta
position 115
XR_001597393.2 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Manis pentadactyla uncharacterized LOC118908090 (LOC118908090), ncRNA. (501 bp)
ctgggaggacagagggcgactggttctttgaggagctgcaccagctctcccttgcccacccttttcacctgaggaaaatatgaaaaagaacacagttcctgaggattgctctgggatggggaaaacttgatcatcttctgccccttgtgctcacagaaactgtttgaggtctgtctcctggggaccccaccctccatttttaggactgaatacctgaagtacagttgtcatcctgttgaatcttatgttacctgcattttatgtcttcaacttctctggttttgtttaagcaaacaatctcttcttgagaagggacagaagggaaataaaattctagatacccaatgtgtccaaaaa
position 439
XR_005023066.1 - Manis pentadactyla (Chinese pangolin) - NCBI
PREDICTED: Acropora digitifera uncharacterized LOC107337268 (LOC107337268), ncRNA. (444 bp)
including 41 samples with support for all annotated introns" /db_xref="GeneID:107337268" ncRNA 1..444 /ncRNA_class="lncRNA" /gene="LOC107337268" /product="uncharacterized LOC107337268" /db_xref="GeneID:107337268" ORIGIN // cagaatgggtgttcctcttgtggttttgcttgaattctgttctgagggtgataacgtcttgatgccgtcaatctcttcttgtctgctaatgagtggctcaaatttgttcccacgaaagaggtggaaaatccgttctttggacaaacaagtaattttgggattccagcatcttggtctttaatgtttggatcaccaatgcattggcatggaaacctattttagtgaggcagactcatgagttatgtacttaccataactttcacgtttgtttgatcactgttttgcgcttagtttagcaaggaacctctccatgttacgggtcattatttgtagtatttgctcaaaacgttaccatgaaacagctaccacgtgtcaaa...
position 69
XR_001562778.1 - Acropora digitifera - NCBI
Trematosphaeria pertusa uncharacterized protein (BU26DRAFT_500137), partial mRNA. (528 bp)
CA 94598-1698, USA atgaccgacaccgcggactttgagcaattttgcttaactacactctacaatgctattccgatgctcgacaaccccagcgaccggtacgagtggaataatagggtgtgcgattttattgagatttcctctgtcgccgaagatggtgctcctccaccaaacaaagatcaggcaaaggaatggtatcgccgacagaaactctacacagccatgatcatgaagaagctgtcgcacaacgctgcgccgcgaattaaggccttagggatcagtgacgtgcaatctcttcttgaagctgtgcgagagcgcttcaactttagccgcctcaaggacgaggcaatcgaggaagagtaccgatccggccagcggggcaatgagccggcgaaggcgcagcgtgttagcaaccagattcaaactcttacccgccagatattgatatcaccggacgaaaccagatgccagattcacatagacaaggttccgttttgctcattttgtcccaccaaactcgcacagcaacccagaaacatttag
position 274
XM_033826478.1 - Trematosphaeria pertusa - NCBI
Laccaria bicolor S238N-H82 hypothetical protein partial mRNA. (411 bp)
Wuyts,J., Martin,F. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (19-NOV-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA atgtactctcggtctccatggcctgttgcatctcctgctgcaccactctcaagtggtaatcaatctcttcttgtcattcacggcgaacttcctcttgcctctgttctcaagtatttggatgagaattgtgtcgatgagaccaacattgtcgatggtgacacagacgtcgtcaatggtgacgcagacgtcgtcaatggtgacgcagatgtcgtcaatggtgacacagacgtcgacggtgatgtagacgtcgtcggtgttgacacagatggtggcacagacgtcgtcgatgatgacacaaatggtggcacagacgttgttgatggtggcacagacactgttggaggtgacacagacgtcgaggttgagc...
position 61
XM_001879458.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Drosophila subpulchrella uncharacterized LOC119551309 (LOC119551309), mRNA. (513 bp)
tgcatagagctgaagtgcttctgcatcctgatagccatcgtggaggtgctcatccgcgggttggatcgtttttttgtggatcgcgacagcatcctgggatttttgtccctcgtggtgagcggtatctacgtaatctgctgcatattccttcttcttggagccgtgctgggggtaaggtactttctgttgccctacctctcggtttcctgcctccgcttccttattttggttgccgagggcgtgtttgtggccacggaaggcttcgtcaatgaatatcttgtcttcgatgttctccaatctcttcttggtctatacttttggctggtggtcttctcctactacgatctgttgaaggacacctgagtttatatatttgtgcttacttttatattgtaaaaaatacttgtttagatctgagt
position 389
XM_037860603.1 - Drosophila subpulchrella - NCBI
Brettanomyces bruxellensis uncharacterized protein (BRETT_000934), partial mRNA. (543 bp)
Research, Australian Wine Research Institute, Corner of Hartley Grove and Paratoo Road, Urrbrae, SA 5064, Australia atggttgcataccaatttagttccgtttgtgagaattgtgaactaaatgtgaacatgagtgactcagataaaacagacaagaaatttccacgctcttctctttccagaacaactacaacgactagcataactacccctgttcacccaatggaattggttgtacaatctcttcttgaatcacctcttgagcttctaaatttgagtattcattcattgtatgaatcgcaaatgattctcacaacaatattagatcgaatgcagcggaaacttgacaaatgtcttaggggcattggtaaaagtaggcaagaaccaattactactgacacagatacgcaaaatttacaatatccaaacgagcatcgaaatagggcaaactcagatgatgatctgacaacacagccaggaccagacaaaagcttgacaattgaagaatatgctgccagaattcatacgatcaagctccgcattgtaaaa...
position 163
XM_041279492.1 - Brettanomyces bruxellensis - NCBI
PREDICTED: Fukomys damarensis uncharacterized LOC104847975 (LOC104847975), ncRNA. (576 bp)
RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:104847975" ncRNA 1..576 /ncRNA_class="lncRNA" /gene="LOC104847975" /product="uncharacterized LOC104847975" /db_xref="GeneID:104847975" ORIGIN // ctggtgaatggaggctgacttcttgctctccaagaactgcaagtagctacccaatctcttcttgaaatcagcagtctgtgagctcactgtagtggggcagccagaaccttaaagcctaacaatgggacagtgacaagaagagaggtggagagaaactttcacagtccccctcttccactccaagagaagaaacacacggctttattatggtaccaagtccacctccagatagaagcaatacatctcctcttgaacaagactgtttctccagtttaagcaaatctatccaaactacctccaagctgcagtgaatcatacggtggctgaaggaactacactaagaaggacttgaaagactt...
position 52
XR_776269.2 - Fukomys damarensis (Damara mole-rat) - NCBI
Aspergillus piperis CBS 112811 hypothetical protein (BO85DRAFT_383017), partial mRNA. (453 bp)
gtcttaaagctcatcgaatccaccaccatggatttccgcaacctatcattcactctcctcctgctatccactacagtcatgttatatttcagggctctattagcgcatcccatccacattattagcacccctgaatcagtgcagactgcagaaccagcgccaaccgacgccctcgccttcctcgacgagcccgtcttcaaaccactggcatctcacatagcagaccacccatatccatggcgtgataaacgtccattccaggagaccaattatgcgttactcatgggtgcagttcaatctcttcttgaggctgaggttgacgaggaagagggtggtgtgggtttgaacgagggtcatgggcaacaggacgtcgttgagattaactcgtctgagacatacattctctgggttggggataaggatgatgagaagtgttcttgcgcttag
position 301
XM_025656494.1 - Aspergillus piperis CBS 112811 - NCBI
PREDICTED: Lingula anatina protein FAM84B-like (LOC106176727), mRNA. (474 bp)
ggcagtgttagattcccttgtgccgggagacctggtggagttccaaaggtcgtggctcttctcccactgggccgtttatattggtaatgaagaagtggtccattttattgaacgcaattcaggaggtgtcttcagttcctctagtgagcgttctatgacgggggtagttcgaagggattccttttggacagtggcagggaggagtaaggcgttcaaaaacaacagaagggacgccaaatacagctgtgatgtgatagtgacgagggctctgtcaaagctgggagtgagcgagttcaatctcttcttgagaaatagtgaacattttgtagcctggtgtagatatggtgaagagtgcagtgaacaggcacaaaccatctggacaatgtttttggggtctatggctgtaattgtggggggcattgccgcactcactggccttaggcgatag
position 321
XM_013559232.1 - Lingula anatina - NCBI
Arabidopsis thaliana hypothetical protein (AT2G18970), mRNA. (531 bp)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA tccaatctcactcaaaatctcctccatgttcatctcttctccacctggcaaaagcttctgcaattccttcaatctcttcttgatctctcctccttcttcttcttcgtcgctgtcttggtgtttttctccaccttgtctcttgctcgatctttctagaatctcggaaggagaactactagtgctaattggatcatcataaggggaagataatagcttctgttgcaagaaacggctccacgcgaattcttgagcagacaatgcgaaagccatgtctacttcatgtttcacgggttcttgtttggttggagagaaaagactcgctttctcttgtttataatttgcctctccatgtgaaatttgtttgcttcgtcggaactct...
position 70
Synonym: F19F24.17; F19F24_17
NM_127454.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Meira miltonrushii Isochorismatase hydrolase (FA14DRAFT_152158), partial mRNA. (618 bp)
caaaacttttgaggggcgctcaaatcttggagatcccagttttcacaactgaacaaaactcgaaagctcttggatcgacggtagacgttctcaagaaagatatcccagaaaattccacaatcgttgacaagacccgattcagtatggtattggacgatggaacaacagataaatggctacgcgatcacaaagttcaaaatgtgatgattgtcggaattgagagtcacgtatgcgtcttacaaacgacattggacttgctcaagaaaggcttcaacgttttcatcattcgtgatgcaatctcttcttgtaataaacaagaagttccacttgccatcgaaagaatgcgtttggctggcgctacaatcacaacatccgaaagcgctctgtttgaactgatgctagattcaaaacatccccatttcaaagctatcagtgggctaatcaagacggaaaaggacagtacaaaagccgctcttgaagcactcacatcacgtatttga
position 413
XM_025497511.1 - Meira miltonrushii - NCBI
PREDICTED: Syngnathus acus prefoldin 5 (pfdn5), mRNA. (612 bp)
gttttagtcgatgtgggaacaggatattatgttgaaaagaatgtagcagattccaaggcattcttcaaacgaaaactagatttcctgacaaagcaaattgagaaaattcagcccgcccttcaggaaaaacatgccatgaaacaagctgtcattgaagtcatgaatgtgaagatccaacagctacaacagagtaaacaggcttccagcaccaaggcttaattgtgacaacacttaaatgaatgctttttgtgtgtgtgaaaaagaactgtaaaatgtcctgcactgacctttatacaatctcttcttgcataatttggaaataaagggttagtgaacattaa
position 566
XM_037252075.1 - Syngnathus acus (greater pipefish) - NCBI
PREDICTED: Arabidopsis lyrata subsp. lyrata ubiquitin-conjugating enzyme E2 36-like (LOC110230388), mRNA. (391 bp)
gtgattttagacattgggaaatggtggaatcatatgagcagcatggtgatgaaaatgatgggcatgttccatatgtaccttctggtgacagaattatggaggatatgcgggattctatcactacagagatggctgaaggaacgagacttccatattaacagctcccggtatttcaatgttatgattcttggacctacacaatcaccttatgaaggagttgggtttgaatcgagaagcaaatacttgtttggtaaagtctctatctagattaagcaaatcgaggaacaaaaccaatctcttcttgctctgttttaagacactgctttgattattatgtccctaatcttacattatgaatgtatttcactaaagcagtgacattggttggttt
position 292
XM_021033133.1 - Arabidopsis lyrata subsp. lyrata - NCBI
PREDICTED: Cucumis sativus ripening-related protein grip22 (LOC101211270), mRNA. (648 bp)
misc_feature 397..636 /gene="LOC101211270" /note="Rare lipoprotein A (RlpA)-like double-psi beta-barrel; Region: DPBB_1; cl04011" /db_xref="CDD:296184" ORIGIN // atggcaaaattggcttgcttggtctcttttttctttttggttctttctcttttgggcctttctcaagcaatctcttcttgcagggagccatgtcaaaccttgaaaaattgtaaaggtcaattgatttgtataaatggccaatgtaatgatgatcccgatgttggaactcgcatttgttcaaccgacagtgataacggagcagatggagaaaaatttcgttgtgaggcatttggaagattacattgcaaaggcaaatcgttcccccaattcaaatgctcgcctcgagtgacttcctcaactcgagctatcctaacaaataatgactttagtaaaggtggggatggaggagacccgtctgagtgtgatggaaagttccatcataactctcaaccaatagtggcattgtccacgggttggtacaacgggggatctagatgt...
position 68
XM_011658707.1 - Cucumis sativus (cucumber) - NCBI
Aspergillus costaricaensis CBS 115574 hypothetical protein (BO79DRAFT_277183), partial mRNA. (511 bp)
Creek, CA 94598-1698, USA atggatttccgcaacctatcattcactctcctcctgctatccgctacagtcatgttatatttcaggactctactagcgcatcccatctacatgattagcacccctgcatcagtgcaaactccagactcagcgccaaccgacgccctcgccttcctcgacgagcccgtcttcagaccactggcatctcacatagcggacaacccatatccgtggcgtgataaacgtccattccaggagaccaattttgcgttactcatgggtgctgtccaatctcttcttgaggctgaggttgacgagggagagggtggtgtgagtttgaatgagagctatgggcaacaggatggcattgagagtaactcgtccgagacatattttctctgggctggggaagatgagaagtggtcttgcgcttagcaaaagcgctcagaggagttgagaaagtgaagatggtccttcgagacctgggattgtgagaagttcatttttggaaagtgggtttaaaacccactat
position 268
XM_025687799.1 - Aspergillus costaricaensis CBS 115574 - NCBI
PREDICTED: Belonocnema treatae uncharacterized LOC117172993 (LOC117172993), transcript variant X1, mRNA. (617 bp)
LOC117172993" /protein_id="XP_033217224.1" /db_xref="GeneID:117172993" /translation="MSTGAGMGGGIGGGTGGGYGAPASTTATKAAAPKKDEDIITTMKHKVTESTMYRHVRHPIDHLGCKHHLKKKGCRVHKKRPPRAPMGGGMEGGMAGGGMMAGGMG" ORIGIN // gcggcggttaacgcgtcaaggattatccgtcctcggtagctttgcttgagaattgagagggttaacctgcccgaaggatttcttcaatctcttcttgttcagtttaaatttttatttttttccgaactgctacacagtaacgagggccaggaaagtaatcgagcaaggcaatgagatttgtagagatgtaggtgcacaagagttgggaacgacggcgacaggtatgagcacgggtgctggtatgggtggtggtattgggggtggtacagggggaggctatggagctcctgcatctactaccgcaactaaagccgcagctcccaaaaaggatgaggatatcattactacgatgaaacataaagtgacagaaagcactatgtacagacatgtacgccacc...
position 85
XM_033361333.1 - Belonocnema treatae - NCBI
PREDICTED: Herrania umbratica uncharacterized LOC110427542 (LOC110427542), mRNA. (417 bp)
misc_feature 144 /gene="LOC110427542" /note="gag-polypeptide of LTR copia-type; Region: Retrotran_gag_2; pfam14223" /db_xref="CDD:316719" ORIGIN // atggcagaatgcagttctattagaccccatgtgctgaagatgattgaactcatcgagagacttggacaattgggattagcaatggatcatgagcttagtatagacttagttctacaatctcttcttgacagctttagtcagttcatgttgaacttccatatgaatcgattggaagccacttttcttgaacttttgaatatgctaaacatggtagagtggtccatcaggaaagataaaggatcattgcttcttgtttcttcttttgaggctcatacgaaacaacagaagaagaaagcccaaaaagggaagaaggtaaaatctcaaaatgagaaggtgctgaagcctaagagaggtgtcaaaaaggacaaagagaaagatattttgccatcattgtggcaaacttgggcattggaatag
position 115
XM_021443097.1 - Herrania umbratica - NCBI
PREDICTED: Dioscorea cayenensis subsp. rotundata uncharacterized LOC120275457 (LOC120275457), ncRNA. (148 bp)
samples with support for all annotated introns" /db_xref="GeneID:120275457" ncRNA 1..148 /ncRNA_class="lncRNA" /gene="LOC120275457" /product="uncharacterized LOC120275457" /db_xref="GeneID:120275457" ORIGIN // tgaaacccaaatcatgttttatgtttatggttgtagtaatgttcttcgtcatgtataagttgacaaaattccaacaggcacaagaagagattgaatcagtatctcagacttttgattccatgatgaggaggacaccaaagaagctgta
position 81
XR_005541109.1 - Dioscorea cayenensis subsp. rotundata (Guinea yam) - NCBI
PREDICTED: Helianthus annuus uncharacterized LOC110938512 (LOC110938512), ncRNA. (219 bp)
ncRNA 1..219 /ncRNA_class="lncRNA" /gene="LOC110938512" /product="uncharacterized LOC110938512" /db_xref="GeneID:110938512" ORIGIN // ctcaagtacggcgtgcaacaagtgcctacccacgtcgtcaaagaactcatcatgcacgaggtggtgcttgggggtggccaggatgcatctgctgttaccacaaccatcatcgtgcggggaagtttgaagccaaattttatgacaaggttctgcaagaagagattggaggcgttaaaggacatttcgggccaattaatgctttggcattcaacccggatg
position 153
XR_002591448.2 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Pseudonaja textilis uncharacterized LOC113437314 (LOC113437314), ncRNA. (153 bp)
including 1 sample with support for all annotated introns" /db_xref="GeneID:113437314" ncRNA 1..153 /ncRNA_class="lncRNA" /gene="LOC113437314" /product="uncharacterized LOC113437314" /db_xref="GeneID:113437314" ORIGIN // acaatcatccaatggaacagcttgccatcagaagctgtgagtacttcatcacttgagactttcaagaagagattggactgtcatttttcagaaatggtgtaggtctcctgcttgggcaggggtttggactagattacctacaaggtcttttcc
position 63
XR_003374214.1 - Pseudonaja textilis - NCBI
Aspergillus eucalypticola CBS 122712 endo-1,4-beta-xylanase 3 (BO83DRAFT_446547), partial mRNA. (701 bp)
tcgagaattacggtgattacaacccttgcagctcggccacaagccttggtaccgtgtactctgatggaagcacctaccaagtctgcaccgacactcgaacaaacgaaccgtccatcacgggaacaagcacgttcacgcagtatttctccgttcgagagagcacgcgcacatctggaacggtgactgttgccaaccatttcaacttctgggcgcagcatgggttcggcaatagcgacttcaattatcaggtcgtggcggtggaagcatggagcggtgctggcagcgccagtgtcacaatctcttcttga
position 688
XM_025536602.1 - Aspergillus eucalypticola CBS 122712 - NCBI
PREDICTED: Benincasa hispida kiwellin-like (LOC120089464), mRNA. (654 bp)
misc_feature 265..648 /gene="LOC120089464" /note="double-psi beta-barrel fold of the kiwellin family; Region: DPBB_kiwellin-like; cd22270" /db_xref="CDD:409007" ORIGIN // atgacaaatttaagatcgcaactattttttgttattctatctgtcatttctatttttcatctttgtggcgcaatctcttcttgcaatgggccatgtcacactctaaacgattgtcaaggaaaattgatttgcataaatggaatatgccaggatgatcctaaccttggcacacacatttgttccggcggtggaggaggatcaggtccaccatcttccggcaacggttgtcattcaattggaaacttgaactgcaagggaaaatcctttccccaattcaaatgctcgcctccagtgacatcttctactcgagccgtgctgacaaataacgactttaccaaaggtgggagtggaggggacccgtcagagtgcgatgggaagttccatgataactctgacccaatagtggcgttgtccacaggttggtacaat...
position 71
XM_039046945.1 - Benincasa hispida (wax gourd) - NCBI
PREDICTED: Trematomus bernacchii all-trans-retinol 13,14-reductase-like (LOC117496684), mRNA. (1486 bp)
gtccgggccatagagatcaaatgtgtctgtacgctgctcaatatcctcttcattggtctatttcatatcatttcaggtgtccctcctaaagagtccagctttctgatcaatgctctccttcttcaacactacaagcgtggtgcctactactcacaggggggcgccagtgagtttgccttccacatcatcaatgtcattgagaaggcgggcggtgctgttctcgtcagggctccggtacaccgcgtcctgctcaaccggcagaacaaggcctatggtgtgacggtgctcaaaggacaagaagagattgaggtccatgcccctgttgtcatttctaatgctggcattttcaacatattcgagaagtttctacctcagcccatacaggagaaaccaggtgtccctcctaaagagtccagctttctgatcaatgctctccttcttcaacactacaagcgtggtgcgtactactcacggggggcgccagtgtgtttgccttccacatcatcaatgtcattgagaaggcgggcggtgctgttctcgtcagggctccggtacaccgcgtcctgctcaaccggcagaacaaggcctatggtgggaaaa...
position 370
XM_034148409.1 - Trematomus bernacchii (emerald rockcod) - NCBI
PREDICTED: Contarinia nasturtii odorant receptor coreceptor-like (LOC116344513), mRNA. (719 bp)
tcgtttgttatcgatatcaaggaaagtttggatcaattcaattgtctcattaatacgaaagataggagcaatcgaatcaagattaaacaacaaatatgcgagattattcaatttcatgcagactccaggcaacttgcctatgatctatccggtgcatacagaaaacaaatttttctatatttctcaatttcggcaatgtctataaccagttgcttgtggcaaatcagtaaggcaattttattgggggaaataatcgaagcacttcatatgctaatgatgctgtgcatccattcgcaatctcttcttgcgttttgttactttggggaactagtgaccggaaacattgacgatgtgaatgacatgttttggcagtgtgattggtactatttaccgattaaaattcaacaacttatgccgatcatattaatgaattccgaaaaaacaatttacattggagaatgtgctggacttaatgcatctcttgatgtgtttggcaaaattattaaagctgctgtttcttacttgacaatattgcgacaatttgattgaatttaaatattattaatctagtgcaaggcgatacatgtgatgtccgaagta...
position 310
XM_031773100.1 - Contarinia nasturtii (swede midge) - NCBI
PREDICTED: Helianthus annuus splicing factor 3B subunit 4-like (LOC118489099), mRNA. (731 bp)
ORIGIN // ataaataccgtaatgtaatgtagtagccttactaaaaaaagcggtggtgacaagatgtggccgagaaatgaagcagacagttatgctgcccccacaggtttctttggtagcttttgcaacgcaatctcttcttgccttggtttgttatgttgctgttggctcttacgagactgttttggccgggaacgaagaagaccaactactcctttattggctccacctccaagcccagcggatgatcatcttgcacatttaggaggtccccatagtccatttgaaccacgtcctccaggccggatggaagatcgtcttggaggtcaccacagtccagatgggctgtctaacccattcggtcatcctggtcggatggatgatcgccttacccatttaggagacccgcacagtccattcagggcgactaagccaccccctcatccaggcccagttgatgaccgtcttgttaacttaggaggtcctcacagtccatttgggatgtccgatgcacccgctcctccagacctacacaggcctcctatccagcatggttctatggttcaccctggacctccccacccatatggaccgccagg...
position 122
XM_035986703.1 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Medicago truncatula UPF0481 protein At3g47200 (LOC11444351), partial mRNA. (684 bp)
tcagctaatgatgtttctgctcttcattataaaggggttattcatcattctttaggaagtgatgaacatgtcgcggaattgatcaacaacatagctaaagaaatagttcctgatatgaatgagtcatatttgtacaaagtggtgaatgaggcgaatgagtatttgggttgttggcgtgcgagattcagagcttcgcttgttcataactatttaacaagttgggctgtgggactttctacaataggtgctcttttggctctttattttacattcatacaagctagttttaccttgcaatctcttcttgtatttatataa
position 661
XM_003594878.3 - Medicago truncatula (barrel medic) - NCBI
PREDICTED: Lepeophtheirus salmonis NPC intracellular cholesterol transporter 2-like (LOC121118412), mRNA. (685 bp)
tattgtctttgttatttcaacaaaatgaagtcttttctcattctaattactttagtttcgcttaccttcggactggaaattcgtgactgcggttcccaaggagcagaaatcacaaaaatcgacttcccaacatgtattaaagagccctgtgttgttcataggggtgatcagctcaaagccaaactttatttgaaagccaaaaaagcaacagactatttggactgcgaactttcagctattatgagtggtattgagttgccttacccaggaggttgtgatgaagcagatgcctgccaatctcttcttgaaggagagtgccctgtagaagaaggagcagagcttatctatgacgtcagcatttatattgacaaaatcttccctacaattgttgtggatggaaaatggaaacttttggatgaggatgaagaggttttctcttgtttcaatatcaaaatggatataagagactaatttgaaaacagttatacttataagacacaccctttgcttcaatggaccacttcgcatatttaaaattaaataatatcataattaatacttttctaaattagtacttgtttttattgatctcgaaaaaaa...
position 366
XM_040712993.1 - Lepeophtheirus salmonis (salmon louse) - NCBI
Aspergillus neoniger CBS 115656 hypothetical protein (BO87DRAFT_442819), mRNA. (588 bp)
tccaagctcatccaatccaccaccaccatggatttccgcaacctatcattcactctcctcctgctatccactacagtcatgttatatttcaggactctattggcgcatcctatctacttcaacaacatcccagggtcagtgcagactccagaaccggcgccaatcgaggccctcgccttcctcgacgagcccgtcttcaaaccactggcatctcacatagcggacaacccatatccgtggcgtgacaaacgcccattccaggagaccaattatgcgttactcatgggtgccgtccaatctcttcttgaggctgaggttgacgaggaagagggtggtgtgagtttgaatgagagctatgggcaacaggatggcattgagagtaactcgtccgagacatattttctctgggctggggaagatgagaagtggtcttgcgcttagcaaaagcgctcaggggagttaagaaagtgaagatggtccttcgagacctgggattgtg
position 384
XM_025628068.1 - Aspergillus neoniger CBS 115656 - NCBI
Trichoderma atroviride IMI 206040 hypothetical protein partial mRNA. (627 bp)
H., Bruce,D., Barry,K., Shapiro,H., Pitluck,S., Baker,S.E., Bruno,K.S. and Kubicek,C.P. TITLE Direct Submission JOURNAL Submitted (05-JUL-2007) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598, USA atggcagctcggtcttccgtttcggctcttcattatttggccattggccgactcggtcgtggtgaagtagtcaatctcttcttgaaagacgcgggaattgaataccaagacatccgatatccttatgatgacacttggtcccggagcagcgaggagctgaagcggaagggactgacaaggactggtaaagtccctgcagtagaatacaagggtgtgactttgaatcagcatattccaaccttgcgctatatcgcccgagatcttggccgctatgatggagaaacaaactgggaaaagtttattgtagacgcagtatcggatgtttacattgattggagattcaaatgggttcaaaatcttgggcaagcaacggacgagt...
position 72
XM_014090450.1 - Trichoderma atroviride IMI 206040 - NCBI
PREDICTED: Cricetulus griseus uncharacterized LOC103163642 (LOC103163642), ncRNA. (277 bp)
product="uncharacterized LOC103163642" /db_xref="GeneID:103163642" ORIGIN // tatagactgctgcatgctggctggctaggttgctctttttaacttagaaagttgaggaaacaacaaagtagaggatgaatggtatctggaggttgacatactgatactcggggaaggtacagatgtgaatttcagcatgaagaaaggaagatattttctgttgttcaaggatgagacataccatatgagagggagccactataggtccaagaagagattgggaccatggagatttccagagacctacaaggatgacatgatctcataatcaaggcaa
position 208
XR_003480888.2 - Cricetulus griseus (Chinese hamster) - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (630 bp)
Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan atgatattggcaccagaatatgacctggatgatggtgtagaatacccaaccaaatcgaaatatagttgggcatataataagataccattgtcaagatctcaatggatgtatctattgattggacaatgtttggtatcaggtgtagttaacttctttgtcaatctcttcttgacatggttaatgtatccaagggatttaggtgcaaccatttcattctctggacaaataacatgtatattctcggacattatagttacatcctttgttctaccaacaataacagcaatcattgcttcattcttggtgacattcgatcttcgtagaggacaattcattcaaccaattgacgagagatggttaaagcatccattcctttcttgggtaccaactggtatcaatattaagatcattttgaagagagcagttatattcggagtgtttggagtatgtatatttgcacctccaa...
position 159
XM_012897855.1 - Acytostelium subglobosum LB1 - NCBI
PREDICTED: Tripterygium wilfordii uncharacterized LOC120008712 (LOC120008712), mRNA. (699 bp)
tggaaaaaggctgatgaaatggctagatgctacatgttagcatcaatgtcagacgtgttgcaaacacaactccagaatatggcaagtgcctatgacattatttatagtctaaaggagatgtttggtgatcaaggcaaagccgcaagacagactgccatgaaaacactcctaaacacccaaatgaatgaaggagccaatgtaagtgagcacactcttaagatgatgagtcttttgaatgagctcgaagtacttgttgctgatattgatggtgaaagccagatcaatatcgtccttcaatctcttcttgatagcaatgagaatttttggctgaactataacatgaacaaaagactttatacgttgtcaaaacttctcaataagcttaaaggagtagagaaacttcaacctaagcaagctaaggtcaatctgaatgagaaaggatcttctactaaaccggaaggtaagaagaagaaaaagactcaaaagaagaataaatcaatcgactcctag
position 484
XM_038859094.1 - Tripterygium wilfordii - NCBI
PREDICTED: Gorilla gorilla gorilla uncharacterized LOC115931024 (LOC115931024), ncRNA. (277 bp)
including 1 sample with support for all annotated introns" /db_xref="GeneID:115931024" ncRNA 1..277 /ncRNA_class="lncRNA" /gene="LOC115931024" /product="uncharacterized LOC115931024" /db_xref="GeneID:115931024" ORIGIN // ggcagctgttggagagggatgggtcaagggatggagggtagcactgtgagctgaaataggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacaatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacactgagcctcatctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggacatgaagagggg
position 64
XR_004067606.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI
PREDICTED: Raphanus sativus uncharacterized LOC108846357 (LOC108846357), mRNA. (504 bp)
CDS 123..434 /gene="LOC108846357" /codon_start=1 /product="uncharacterized protein LOC108846357" /protein_id="XP_018475092.1" /db_xref="GeneID:108846357" /translation="MDTMKIIKLHVILVSFLLIFEVPSILGFSMRGTTRSEPEAFHGREYFSAMKSRKLMVTNLQVDYSADYDDGASSSASPSPPVPDYDDDINKRQGDVPSPAIGH" ORIGIN // caacaccacaatctcttcttggatcctaaacataacaagaagaaagaacacagatacgaattctcttattttcaccatttaatttgattgttttcttgaataggtatatagagctactagaaatggatacaatgaagattattaaacttcacgttatactagtctctttcttactcatctttgaagttccttcgattcttgggttcagtatgagaggcactactagatcggagccggaagcatttcacggcagagagtacttctcggcgatgaagagcaggaagttgatggttacaaacttgcaagtcgattattca...
position 9
XM_018619590.1 - Raphanus sativus (radish) - NCBI
PREDICTED: Theobroma cacao uncharacterized LOC108661919 (LOC108661919), mRNA. (507 bp)
cgtcataaggatgacgatgatcaggcagcatgcgtgatgctaaccagtatgactcctgagctccaaaagcagtatgagcacatggatgtccaatccataattcttcatcttagaaaattgttcgataaggaatggcgcattgagagatatgagatctctaaagaactattccgatgcaagatggtagaaatgagttttcttagaccccatgtgccgaagatgattggactcatcgagagacttagacaattgggattagcaatggatcatgggctaagtatagacttaattctacaatctcttcttgacagcttcagttag
position 481
XM_018120908.1 - Theobroma cacao (cacao) - NCBI
Diutina rugosa uncharacterized protein (DIURU_003940), partial mRNA. (300 bp)
for Genomic Regulation, Carrer Dr. Aiguader, 88, 5, Barcelona 08003, Spain atggctaagtctggtattgctgttggtctcaacaagggtcacaagactaccgctaaggaagtcgcccccaagatctcgtacagaaagggtgccctcaccaagagaaccgagttcgtcagatcgatcgtgtcggaagtcgccgggttggctccttacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagagatgaacggtgtcatcgctgcttccagaaagcactaa
position 216
XM_034156758.1 - Diutina rugosa - NCBI
Saccharomyces paradoxus Gyp5 (SPAR_P00270), partial mRNA. (303 bp)
and Aging, Nice (IRCAN), 28 Avenue de Valombrose, Nice, PACA 06107, France atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagctccaaagatctcctacaagaagggtgctgcctctaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
position 219
XM_033913633.1 - Saccharomyces paradoxus - NCBI
[Candida] duobushaemulonis uncharacterized protein (CXQ87_002009), partial mRNA. (684 bp)
acacggccagctccgagccatgagccagtcacgtggcaggattctccatgcccgctccatctatcttcacacaggcccccgcgtggcaggtctccgcagagaccccaaggaggctttcaagacccaccagggcgtcgaatacggttctgaagaggccaccagcaccatcaagcaatttctagccaattacagcattccagaggaaatggcccgccaggtgctcacgcacaagtcgttcggtaacggtatcaaggcgtacaatgaaaaactcgtcgttatgggcctgaaggtgctcaatctcttcttggccaagcatgtcattgagcagcccacggaaaacgaaaacgccatcaacggcaagaaccttgatgtcttgggcacccgtgtctccaaggagctcggaagcaaaaccgcccttggtgttttcgccaaacagcacaacctcaaccagacgatgttctggaaactgcacaaccaccatcttctgtttgaagccagtggcgaaatgaagatcagcgcccacgtcatgtatgcgcttgtaggagctgtggcgttcgtccacggcaagaaaatggccgagcagtttgtccgtgagaagct...
position 315
XM_025480531.1 - [Candida] duobushaemulonis - NCBI
Arabidopsis thaliana transmembrane protein (AT2G02795), mRNA. (687 bp)
ttgtctccaccattctcaaagaacttgcttttagggttcttgccattctcctgctgtatttcaatcttggtgtataagattacatcactgctcaccaccacgagcctgctcgacgtgctgctggttgggcagcagataagcatcttgttcatgtgcatttgcggggtctctgcttttatgggattattcaattatatccaccggctctctgttggggtcttgaatgagccgcccaagcccaacgaagctatgacatccttgctcaatgcaatgaagaatgagcaagaaagtacacaatctcttcttgctgcagcaatgattttggctgtgactgagcctgagaatccaagcatcctcacgttggttaacgcattgaaagaacgttatgctaccgctccttccatttaacacttgaaacacccaatgtttgcttctgtttatgtattttcttctatctagttgactttttggatttttgtttcttaggattattgtgtttcaatcctttgactcttttcggatttgtggttttatttatgaatttgtgtttcttaggagtctcttgcgtttaacctatgtatgtctctg
position 394
NM_001335146.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Zootoca vivipara uroplakin 1B (UPK1B), mRNA. (783 bp)
cgtcatggggtgttgtggccttgcactcatggcagagtgtatattcttcgtgtcagatcagcagtcactttatccattgttagaagctactgacaatgatgacatctatggtgctgcctggattgggatcttcactggcttcgctttcttttgtatggcagtccttggaattgttggcgtcgtgaagtcaaataggacaatgctattggtgtatatcatcctgctgatgatagtctttgcctttgaagttgcctccagcatcacagcagttgtgcatcgagactttctcacccccaatctcttcttgaagcaaatgttggaaaaataccagaatccagaccccatcaacaatgacgacaagtggaagagtgaaggggtcaccaggacatgggatcggctcatgttgcagaatcactgctgtggtgtggaaggcccatcagactggcaaacatataactctgtatttagaaaaaggaatcaagatgcagattttccttggccacgccagtgttgcgtaatggatattctaggaaaatcaaccaacgtggatgcctgcaaactgggggtggatggctattaccataaagatggctgctatcc...
position 354
XM_035115573.1 - Zootoca vivipara (common lizard) - NCBI
Saccharomyces eubayanus RPL36B-like protein (DI49_5219), partial mRNA. (246 bp)
of Genetics, University of Wisconsin-Madison, 425-G Henry Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atgactccagctccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcatcagagccaaggctaaggtcgaggaaatgaacaacatcatcgctgcttctcgtcgtcattaa
position 162
XM_018368212.1 - Saccharomyces eubayanus - NCBI
PREDICTED: Belonocnema treatae uncharacterized LOC117172993 (LOC117172993), transcript variant X2, mRNA. (742 bp)
LOC117172993" /protein_id="XP_033217225.1" /db_xref="GeneID:117172993" /translation="MSTGAGMGGGIGGGTGGGYGAPASTTATKAAAPKKDEDIITTMKHKVTESTMYRHVRHPIDHLGCKHHLKKKGCRVHKKRPPRAPMGGGMEGGMAGGGMMAGGMG" ORIGIN // gcggcggttaacgcgtcaaggattatccgtcctcggtagctttgcttgagaattgagagggttaacctgcccgaaggatttcttcaatctcttcttgttcagtttaaatttttatttttttccgaactgctacacagtaacgagggccaggaaagtaatcgagcaaggcaatgagatttgtagaggagaaaaactggaacggtgtccactcttcggaattaagaaccgactgaaatggactaaaagaaaaagaataacagacacagacgacatgcgacgtgccggtttgaaaataagcacgtggtgactgatgtaggtgcacaagagttgggaacgacggcgacaggtatgagcacgggtgctggtatgggtggtggtattgggggtggtacaggggg...
position 85
XM_033361334.1 - Belonocnema treatae - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/both%3acaagaagagattg
lang : en | div : | spe : | query_string : both:caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.080 | 0.080 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((nt:caagaagagattg)%7C(nt:caatctcttcttg))?to=0&format=json
0.133 | 0.053 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((nt:caagaagagattg)%7C(nt:caatctcttcttg))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.140 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]