GGRNA ver.2 Help | Advanced search | English    旧バージョン

2026-09-01 09:35:57, GGRNA : RefSeq release 233 (Jan, 2026)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: Claudin-11; Claudin11; Osp; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 4, non-coding RNA. (2143 bp)
08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..734 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 735..2143 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2143) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NR_045517.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 5, non-coding RNA. (2005 bp)
exon 176..485 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..2005 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2005) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NR_045518.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 25 (Cldn25), mRNA. (786 bp)
Gm16492; Gm513" /note="claudin 21, pseudogene; claudin 25, pseudogene" /codon_start=1 /product="putative claudin-25" /protein_id="NP_001371194.1" /db_xref="GeneID:100042785" /db_xref="MGI:MGI:3642767" /translation="MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLTLDLNEMETWVSGLWEACVNQEEAGTVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLSSCGLECFRFHRPGGVFKTRLCLLGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLAVGGLLLIFSACLENEDGSSSWMADATAPQACAPVEEEFDGSFHLTPRPVNQVI" misc_feature 124..597 /gene="Cldn25" /gene_synonym="Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513
NM_001384265.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 24 (Cldn24), mRNA. (663 bp)
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466554.1. On Dec 14, 2007 this sequence version replaced XM_001473536.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: Gm10107
NM_001111318.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 20 (Cldn20), mRNA. (660 bp)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466633.1. On or before Oct 13, 2007 this sequence version replaced XM_904536.1, XM_888581.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: EG621628
NM_001101560.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 2 (Cldn2), transcript variant 1, mRNA. (3069 bp)
culus claudin 2 (Cldn2), transcript variant 1, mRNA. ACCESSION NM_016675 VERSION NM_016675.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced NM_016675.4. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_016675.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 2 (Cldn2), transcript variant 2, mRNA. (2899 bp)
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced XM_006528490.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_001410421.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. (852 bp)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160099.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. (1035 bp)
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160098.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v2, mRNA. (1092 bp)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160097.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. (1143 bp)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160096.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a, mRNA. (1200 bp)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_023878.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin domain containing 1 (Cldnd1), transcript variant X1, mRNA. (2053 bp)
Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /codon_start=1 /product="claudin domain-containing protein 1 isoform X1" /protein_id="XP_011244188.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <627..809 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: 1110019C08Rik; claudin-25; Cldn25
XM_011245886.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34C2 (Cldn34c2), mRNA. (857 bp)
gene_synonym="EG625591; Gm6604" /codon_start=1 /product="claudin 34C2" /protein_id="NP_001365203.1" /db_xref="GeneID:625591" /db_xref="MGI:MGI:3644765" /translation="MVLLNKSANHQIRGFTLATIACIMCNTSMALPEWRICYLNNSMLSYPSLAFVNIWEAYICHHNHNSSHLRDCHYYTCHNNLVPLDIRVSQILLLVANVVGLVGTVCSVFALQQLYTEELHKNNDYNPFVLSAVLNAIASTFIFLAVMCNHLSVPSKEEVSFLQSFQMPIFSNAQRAGRAMGLAYISAILFLLSAIIFISYCPSMEIKMFPRV" ORIGIN // REFERENCE 1 (bases 1 to 857) AUTHORS Seker M, Fernandez-Rodriguez C, Martinez-Cruz LA and Muller D. TITLE Mouse Models of Human Claudin-Associated Disorders: Benefits and Limitations JOURNAL Int J Mol Sci...
Synonym: EG625591; Gm6604
NM_001378274.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant b, mRNA. (960 bp)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_021386.3. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_021386.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 3 (Cldn3), mRNA. (1263 bp)
Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK002672.1 and AV041302.2. On Aug 4, 2010 this sequence version replaced NM_009902.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: Cpetr2; mRVP1
NM_009902.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34, pseudogene (Cldn34-ps), mRNA. (639 bp)
LOCUS NM_001101585 639 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus claudin 34, pseudogene (Cldn34-ps), mRNA. ACCESSION NM_001101585 XM_893693 XM_910639 VERSION NM_001101585.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from CH466576.2. On or before...
Synonym: EG628893; Gm6927
NM_001101585.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 1 (Cldn1), mRNA. (3263 bp)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK036780.1 and CK626537.1. On Aug 3, 2010 this sequence version replaced NM_016674.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_016674.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 4 (Cldn4), mRNA. (1827 bp)
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145152.1, BC132378.1 and BQ031935.1. On Nov 15, 2007 this sequence version replaced NM_009903.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: Cep-r; Cpetr; Cpetr1
NM_009903.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34B1 (Cldn34b1), mRNA. (1081 bp)
LOCUS NM_001097980 1081 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus claudin 34B1 (Cldn34b1), mRNA. ACCESSION NM_001097980 XM_001475498 VERSION NM_001097980.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 214..750 /gene="Cldn34b1" /gene_synonym="EG546400; Gm16390" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN // REFERENCE 1 (bases 1 to 1081) AUTHORS Gaudet P, Livstone MS, Lewis SE and...
Synonym: EG546400; Gm16390
NM_001097980.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34D (Cldn34d), mRNA. (1003 bp)
LOCUS NM_001201395 1003 bp mRNA linear ROD 07-AUG-2023 DEFINITION Mus musculus claudin 34D (Cldn34d), mRNA. ACCESSION NM_001201395 XM_135954 VERSION NM_001201395.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...misc_feature 217..759 /gene="Cldn34d" /gene_synonym="4930468A15Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN // REFERENCE 1 (bases 1 to 1003) AUTHORS Gaudet P, Livstone MS, Lewis SE and Thomas PD. TITLE Phylogenetic-based propagation of...
Synonym: 4930468A15Rik
NM_001201395.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34C1 (Cldn34c1), transcript variant 2, mRNA. (3160 bp)
LOCUS NM_001310652 3160 bp mRNA linear ROD 05-AUG-2023 DEFINITION Mus musculus claudin 34C1 (Cldn34c1), transcript variant 2, mRNA. ACCESSION NM_001310652 XM_006528408 VERSION NM_001310652.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK032219.1, BX521033.1 and...
Synonym: 3110007F17Rik
NM_001310652.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34C1 (Cldn34c1), transcript variant 1, mRNA. (3317 bp)
LOCUS NM_028426 3317 bp mRNA linear ROD 05-AUG-2023 DEFINITION Mus musculus claudin 34C1 (Cldn34c1), transcript variant 1, mRNA. ACCESSION NM_028426 XM_888743 XM_912053 VERSION NM_028426.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK032219.1, BC027572.1 and...
Synonym: 3110007F17Rik
NM_028426.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34C1 (Cldn34c1), transcript variant 3, mRNA. (3276 bp)
LOCUS NM_001310654 3276 bp mRNA linear ROD 05-AUG-2023 DEFINITION Mus musculus claudin 34C1 (Cldn34c1), transcript variant 3, mRNA. ACCESSION NM_001310654 XM_006528409 VERSION NM_001310654.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK032219.1 and...
Synonym: 3110007F17Rik
NM_001310654.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34B4 (Cldn34b4), transcript variant 2, mRNA. (1075 bp)
gene="Cldn34b4" /gene_synonym="4930428D18Rik" /codon_start=1 /product="claudin 34B4" /protein_id="NP_001343325.1" /db_xref="CCDS:CCDS53116.1" /db_xref="GeneID:619294" /db_xref="MGI:MGI:3588232" /translation="MLIKNRCNSQMGGFALTTVAWLICCISIGLPQWRVWHFQDPVVFKSTTAFVGMWRVCTLQYDEDFRNMRICHQYNYHDTFLPLNIRMIQQLLLVSSFFGLVGKVTTIIALWNVCQGRVHRKATYNPFGLSGILNIISSSFICLAILINYVSIIFQEGIIFPPSFNIPSQPDTQEIGSAMALAFIAAVLFLLSGTILLTSNFPVDKPVCSKY" misc_feature 289..828 /gene="Cldn34b4" /gene_synonym="4930428D18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: 4930428D18Rik
NM_001356396.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34B4 (Cldn34b4), transcript variant 1, mRNA. (1103 bp)
gene="Cldn34b4" /gene_synonym="4930428D18Rik" /codon_start=1 /product="claudin 34B4" /protein_id="NP_001028971.1" /db_xref="CCDS:CCDS53116.1" /db_xref="GeneID:619294" /db_xref="MGI:MGI:3588232" /translation="MLIKNRCNSQMGGFALTTVAWLICCISIGLPQWRVWHFQDPVVFKSTTAFVGMWRVCTLQYDEDFRNMRICHQYNYHDTFLPLNIRMIQQLLLVSSFFGLVGKVTTIIALWNVCQGRVHRKATYNPFGLSGILNIISSSFICLAILINYVSIIFQEGIIFPPSFNIPSQPDTQEIGSAMALAFIAAVLFLLSGTILLTSNFPVDKPVCSKY" misc_feature 317..856 /gene="Cldn34b4" /gene_synonym="4930428D18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" regulatory...
Synonym: 4930428D18Rik
NM_001033799.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 34B3 (Cldn34b3), mRNA. (1010 bp)
uct="claudin 34B3 precursor" /protein_id="NP_001013782.1" /db_xref="CCDS:CCDS53115.1" /db_xref="GeneID:238829" /db_xref="MGI:MGI:3648293" /translation="MPLKKCHRQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVILKPTVALVGMWRACIFHTDSNSSNTRVCYQYKYDGSIHLYIQVNQHLLLVSSFLGLFGKITTIIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFNLPFQPDIRKMGSATALAIIAAVFFLLSGTICLSSNLAIGKVPHSKM" sig_peptide 165..254 /gene="Cldn34b3" /gene_synonym="EG238829; Gm4937" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 216..752 /gene="Cldn34b3" /gene_synonym="EG238829; Gm4937" /note="PMP-22/EMP/MP20/Claudin...
Synonym: EG238829; Gm4937
NM_001013760.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 5 (Cldn5), mRNA. (1420 bp)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB872815.1, BC083341.1 and BE627334.1. On Aug 5, 2010 this sequence version replaced NM_013805.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: MBEC1; Tmvcf
NM_013805.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 1, mRNA. (2194 bp)
misc_feature 257..319 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 293..946 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 368..370 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_171826.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 6, mRNA. (2209 bp)
misc_feature 272..334 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 308..961 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 383..385 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001356488.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 2, mRNA. (2187 bp)
protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature 286..939 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001252450.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 3, mRNA. (2049 bp)
variant 3; claudin domain-containing protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 3" /protein_id="NP_001239380.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <616..798 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: 1110019C08Rik; claudin-25; Cldn25
NM_001252451.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 14 (Cldn14), transcript variant X2, mRNA. (1357 bp)
db_xref="MGI:MGI:1860425" CDS 432..1151 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_036015927.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 498..974 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_036160034.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 2 (Cldn2), transcript variant X4, mRNA. (1735 bp)
db_xref="MGI:MGI:1276110" CDS 199..963 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528551.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 211..741 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_006528488.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 2 (Cldn2), transcript variant X3, mRNA. (1897 bp)
db_xref="MGI:MGI:1276110" CDS 361..1125 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528552.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 373..903 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_006528489.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 2 (Cldn2), transcript variant X2, mRNA. (1924 bp)
db_xref="MGI:MGI:1276110" CDS 388..1152 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528550.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 400..930 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_006528487.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 2 (Cldn2), transcript variant X1, mRNA. (1938 bp)
db_xref="MGI:MGI:1276110" CDS 402..1166 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528549.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 414..944 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_006528486.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin domain containing 2 (Cldnd2), transcript variant X4, mRNA. (721 bp)
CDS 157..702 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X3" /protein_id="XP_030098889.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLLLSACRHDLAEHRSHQRIPVVRRLIGRCCGAQAQRQIRGGVCDYLD" misc_feature 223..576 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: 1700071E18Rik
XM_030243029.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 14 (Cldn14), transcript variant X1, mRNA. (1154 bp)
db_xref="MGI:MGI:1860425" CDS 229..948 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_006523130.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 295..771 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_006523067.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin domain containing 2 (Cldnd2), transcript variant X5, mRNA. (735 bp)
CDS 155..661 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X4" /protein_id="XP_030098890.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPLCDG" misc_feature 221..586 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: 1700071E18Rik
XM_030243030.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin domain containing 2 (Cldnd2), transcript variant X6, mRNA. (808 bp)
CDS 261..764 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X5" /protein_id="XP_030098891.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPVCL" misc_feature 327..692 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: 1700071E18Rik
XM_030243031.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 34B2 (Cldn34b2), transcript variant X1, mRNA. (955 bp)
CDS 120..749 /gene="Cldn34b2" /gene_synonym="1700042B14Rik" /codon_start=1 /product="claudin 34B2 isoform X1" /protein_id="XP_011246174.1" /db_xref="GeneID:73347" /db_xref="MGI:MGI:1920597" /translation="MPLKKCHGQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVVLKPTVALVGMWRACVFHTDRNSSNTRVCYQYNYDGSIPLYIRGNQHLLLVSSFLGLFGKITTIIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFNLPFQPDTRKMGSAMALAIIAAVFFLLSGTICLSSNLNIDKTPRSKM" misc_feature 171..707 /gene="Cldn34b2" /gene_synonym="1700042B14Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: 1700042B14Rik
XM_011247872.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 34B4 (Cldn34b4), transcript variant X1, mRNA. (989 bp)
gene="Cldn34b4" /gene_synonym="4930428D18Rik" /codon_start=1 /product="claudin 34B4 isoform X1" /protein_id="XP_006528276.1" /db_xref="GeneID:619294" /db_xref="MGI:MGI:3588232" /translation="MLIKNRCNSQMGGFALTTVAWLICCISIGLPQWRVWHFQDPVVFKSTTAFVGMWRVCTLQYDEDFRNMRICHQYNYHDTFLPLNIRMIQQLLLVSSFFGLVGKVTTIIALWNVCQGRVHRKATYNPFGLSGILNIISSSFICLAILINYVSIIFQEGIIFPPSFNIPSQPDTQEIGSAMALAFIAAVLFLLSGTILLTSNFPVDKPVCSKY" misc_feature 343..882 /gene="Cldn34b4" /gene_synonym="4930428D18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: 4930428D18Rik
XM_006528213.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin domain containing 2 (Cldnd2), transcript variant X1, mRNA. (776 bp)
gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X1" /protein_id="XP_017167838.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLLLSACRHDLAEHRSHQRIPGMPMNAACLGQNKGMAFSLAPACFSAERRDRSLETTETRIKWLVES" misc_feature 224..577 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: 1700071E18Rik
XM_017312349.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin domain containing 2 (Cldnd2), transcript variant X2, mRNA. (1016 bp)
gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X2" /protein_id="XP_030098888.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGNQHEGKRVETTPLEDSPPQKLPSHLFFLAKSTITSSDFPAPALQDTRWKRPWNPHP" misc_feature 242..607 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: 1700071E18Rik
XM_030243028.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 16 (Cldn16), mRNA. (1173 bp)
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: claudin-16; PCLN1
NM_053241.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 34B1 (Cldn34b1), transcript variant X1, mRNA. (1107 bp)
LOCUS XM_006528662 1107 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 34B1 (Cldn34b1), transcript variant X1, mRNA. ACCESSION XM_006528662 VERSION XM_006528662.4 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota...misc_feature 239..775 /gene="Cldn34b1" /gene_synonym="EG546400; Gm16390" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: EG546400; Gm16390
XM_006528662.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 34C2 (Cldn34c2), transcript variant X3, mRNA. (493 bp)
LOCUS XM_011247720 493 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 34C2 (Cldn34c2), transcript variant X3, mRNA. ACCESSION XM_011247720 VERSION XM_011247720.3 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: EG625591; Gm6604
XM_011247720.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus claudin 12 (Cldn12), transcript variant X4, mRNA. (3597 bp)
LOCUS XM_011240674 3597 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 12 (Cldn12), transcript variant X4, mRNA. ACCESSION XM_011240674 VERSION XM_011240674.1 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_011240674.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : https://172.18.8.233:20082/ja/mm/claudin
lang : ja | div : | spe : mm | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.084 | 0.084 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Mus musculus (house mouse)?to=0&format=json
0.129 | 0.045 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Mus musculus (house mouse)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.135 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]