ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-28 02:14:00, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_011247721 575 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 34C3 (Cldn34c3), transcript variant X4, mRNA. ACCESSION XM_011247721 VERSION XM_011247721.2 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000086.8) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 21, 2020 this sequence version replaced XM_011247721.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001635.27-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..575 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="X" gene 1..575 /gene="Cldn34c3" /note="claudin 34C3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns" /db_xref="GeneID:382265" /db_xref="MGI:MGI:3645501" CDS 107..457 /gene="Cldn34c3" /codon_start=1 /product="uncharacterized protein Cldn34c3 isoform X3" /protein_id="XP_011246023.1" /db_xref="GeneID:382265" /db_xref="MGI:MGI:3645501" /translation="
MFISKRAARNRTLAGFHIFDASMVLLNKSANHQIRGFTLATIACIMCNTSMALPEWRNCYLNNSMLSYPSLAFVNIWEAYICHHNHNSSHLRDCHYYTCHNNLVPLDIRFQDASQA"
ORIGIN
tactactcagctactaaaaacaaggacatcttgaaatttgcagtcagatgcatggaacgagaaaaggtcatcctgagtgatgtaaaccagatccagaaatacaaacatgtttatcagcaagagagctgcaagaaataggacccttgctggtttccacatatttgatgccagcatggtcctgctaaacaagtctgccaatcaccaaataagaggtttcactttagctacaatagcatgcataatgtgcaatacctctatggcccttccagaatggcgaaattgctacttgaacaactccatgctttcctacccaagtctggcttttgtgaatatttgggaggcctacatctgccaccacaaccacaactcaagccacctgagagattgccattactacacctgccataacaaccttgttcctttggatatccggttccaagatgcatcccaggcttgaacccagacatgagagctgcagactggaccaacaaattggtgtcccacgcaggatctgggaaatggcagaggacacgggaaggaacactgctggtttggagctccatggaagaagaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]