GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-28 02:14:00, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_011247721             575 bp    mRNA    linear   ROD 07-FEB-2024
DEFINITION  PREDICTED: Mus musculus claudin 34C3 (Cldn34c3), transcript variant
            X4, mRNA.
ACCESSION   XM_011247721
VERSION     XM_011247721.2
DBLINK      BioProject: PRJNA169
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000086.8) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 21, 2020 this sequence version replaced XM_011247721.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000001635.27-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/01/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..575
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6J"
                     /db_xref="taxon:10090"
                     /chromosome="X"
     gene            1..575
                     /gene="Cldn34c3"
                     /note="claudin 34C3; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     11 samples with support for all annotated introns"
                     /db_xref="GeneID:382265"
                     /db_xref="MGI:MGI:3645501"
     CDS             107..457
                     /gene="Cldn34c3"
                     /codon_start=1
                     /product="uncharacterized protein Cldn34c3 isoform X3"
                     /protein_id="XP_011246023.1"
                     /db_xref="GeneID:382265"
                     /db_xref="MGI:MGI:3645501"
                     /translation="
MFISKRAARNRTLAGFHIFDASMVLLNKSANHQIRGFTLATIACIMCNTSMALPEWRNCYLNNSMLSYPSLAFVNIWEAYICHHNHNSSHLRDCHYYTCHNNLVPLDIRFQDASQA"
ORIGIN      
tactactcagctactaaaaacaaggacatcttgaaatttgcagtcagatgcatggaacgagaaaaggtcatcctgagtgatgtaaaccagatccagaaatacaaacatgtttatcagcaagagagctgcaagaaataggacccttgctggtttccacatatttgatgccagcatggtcctgctaaacaagtctgccaatcaccaaataagaggtttcactttagctacaatagcatgcataatgtgcaatacctctatggcccttccagaatggcgaaattgctacttgaacaactccatgctttcctacccaagtctggcttttgtgaatatttgggaggcctacatctgccaccacaaccacaactcaagccacctgagagattgccattactacacctgccataacaaccttgttcctttggatatccggttccaagatgcatcccaggcttgaacccagacatgagagctgcagactggaccaacaaattggtgtcccacgcaggatctgggaaatggcagaggacacgggaaggaacactgctggtttggagctccatggaagaagaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]