2025-09-13 15:48:00, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_006528963 1257 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 34A (Cldn34a), transcript variant X3, mRNA. ACCESSION XM_006528963 VERSION XM_006528963.3 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000086.8) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Jun 22, 2016 this sequence version replaced XM_006528963.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001635.27-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1257 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="X" gene 1..1257 /gene="Cldn34a" /gene_synonym="635396; Gm7157" /note="claudin 34A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:635396" /db_xref="MGI:MGI:3779684" CDS 393..1028 /gene="Cldn34a" /gene_synonym="635396; Gm7157" /codon_start=1 /product="claudin-34 isoform X2" /protein_id="XP_006529026.1" /db_xref="GeneID:635396" /db_xref="MGI:MGI:3779684" /translation="
MILFNKGSSRQVGGFAMSTIGWIICITSMGLPQWRVWYAKEPLISYPSMAFVGVWKTCIYHYDNVSNIRMCYHYSYHDTFIPLDIRVSQHLMLTTSLFLLVAKAAAVYALRNVYTGKQEKTVTYNAFGLSAVLNIIGSSFVFLAVLCNYFSIINKEGIAFPPSFHMPFYPHTQQVGIAMILAFLAAILFLCSGVIFISYSFPLNIQVLPKI"
ORIGIN
acaggtcagtgtgaaggcagtaatgagactccaaggacactcgatgagagctgagtcctcatcagtcctcctggctcagttagaggcacactctgctacatcactggtccctggttattatgaggacagcatcattgtttcccagtgttcactgtaaccatgatgcaactcagaaaagataccaatctccagataaaaggatttgctccagccatcctagcatacattctctgcagtgtctccattgggtcttcctcagtgatgagtatggtactttcaagaatccatgaactccaagcccagcattgctttagtgggaatatggagaatctgcatctaccactataacagctttttcagctatatccaagtgtccagtgttcactgtcatcatgatattgttcaacaaaggttccagtcgccaggtaggaggttttgctatgtccaccataggatggattatttgcatcacctccatgggcctcccacagtggcgagtgtggtatgcaaaggaacctctgatctcttatcctagtatggcctttgttggagtgtggaaaacctgcatctaccactatgacaacgtcagcaatattagaatgtgttaccattacagctaccatgacaccttcattcctttggatattcgtgtttctcagcacctgatgttgactaccagccttttcttgctggttgcaaaagcagctgctgtttatgctcttagaaatgtgtacacgggaaaacaagagaagactgtcacctacaatgcctttggcctttcagcagttctgaacatcattggcagtagctttgtcttccttgctgtcttgtgcaattatttctccatcataaacaaggaggggattgcttttccaccatctttccacatgcccttttacccacatactcagcaggttggcattgctatgatactggcatttctagcagccatcctgttcttgtgtagtggtgtgattttcatctcttactcctttcccttaaacatacaagtccttcctaaaatctgaaagtgaatgtgcaccaccttgaaaaaaatcaaaaacttcatgttggttcagcaaggatttttgagatgtctatctgaaaaccaaggactcaacaatgcccaaatggcctgtgacagaaaatggccaaatgcctctttattatcttttctgtctcatttgttttattacttcaatggtcagattatggacttacattaaaataaacttacccacttgtcaattgatctta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]