ver.2
Help
|
Advanced search
|
Japanese
Previous release (v1)
2026-01-25 15:44:15, GGRNA : RefSeq release 232 (Sep, 2025)
Summary:
Results:
Matches are highlighted with green background.
Overlapping matches are dark colored.
gene="Cldn34b2" /gene_synonym="1700042B14Rik" /codon_start=1 /product="claudin 34B2" /protein_id="NP_001075140.1" /db_xref="CCDS:CCDS53232.1" /db_xref="GeneID:73347" /db_xref="MGI:MGI:1920597" /translation="MPLKKCHGQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVVLKPTVALVGMWRACVFHTDRNSSNTRVCYQYNYDGSIPLYIRGNQHLLLVSSFLGLFGKITTIIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFNLPFQPDTRKMGSAMALAIIAAVFFLLSGTICLSSNLNIDKTPRSKM" misc_feature 258..794 /gene="Cldn34b2" /gene_synonym="1700042B14Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN // REFERENCE...
gene="Cldn34b2" /gene_synonym="1700042B14Rik" /codon_start=1 /product="claudin 34B2" /protein_id="NP_082787.1" /db_xref="CCDS:CCDS53232.1" /db_xref="GeneID:73347" /db_xref="MGI:MGI:1920597" /translation="MPLKKCHGQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVVLKPTVALVGMWRACVFHTDRNSSNTRVCYQYNYDGSIPLYIRGNQHLLLVSSFLGLFGKITTIIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFNLPFQPDTRKMGSAMALAIIAAVFFLLSGTICLSSNLNIDKTPRSKM" misc_feature 215..751 /gene="Cldn34b2" /gene_synonym="1700042B14Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN // REFERENCE 1...
misc_feature 257..319 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 293..946 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 368..370 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
misc_feature 272..334 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 308..961 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 383..385 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature 286..939 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region...
variant 3; claudin domain-containing protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 3" /protein_id="NP_001239380.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <616..798 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
start=1 /product="claudin-14" /protein_id="NP_001159398.1" /db_xref="CCDS:CCDS28345.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 552..614 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" misc_feature 597..1073 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
start=1 /product="claudin-14" /protein_id="NP_001159397.1" /db_xref="CCDS:CCDS28345.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 362..424 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" misc_feature 407..883 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
start=1 /product="claudin-14" /protein_id="NP_062373.3" /db_xref="CCDS:CCDS28345.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 554..616 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" misc_feature 599..1075 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
LOCUS NM_001199311 636 bp mRNA linear ROD 02-APR-2025 DEFINITION Mus musculus claudin 34A (Cldn34a), mRNA. ACCESSION NM_001199311 XM_001473639 XM_910435 VERSION NM_001199311.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH466653.1. On or before Dec...
AK037108.1 and AV375522.1. On Aug 14, 2010 this sequence version replaced NM_027998.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes...AUTHORS Katoh,M. and Katoh,M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family JOURNAL Int J Mol Med 11 (6), 683-689 (2003) PUBMED 12736707 REMARK GeneRIF: Report on identification and characterization of human CLDN23....
musculus claudin 17 (Cldn17), mRNA. ACCESSION NM_181490 VERSION NM_181490.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK048287.1. On Apr 5, 2007 this sequence version replaced NM_181490.2. Summary: This gene encodes a member of the claudin family. Claudins are...
ulus claudin 9 (Cldn9), mRNA. ACCESSION NM_020293 VERSION NM_020293.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC154766.2. On Aug 6, 2010 this sequence version replaced NM_020293.2. Summary: This intronless gene encodes a member of the claudin family. Claudins...
DEFINITION Mus musculus claudin 19 (Cldn19), transcript variant 1, mRNA. ACCESSION NM_001038590 VERSION NM_001038590.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF486651.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane...
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
DEFINITION Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. ACCESSION NM_001193619 VERSION NM_001193619.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL596185.12. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL606975.9 and BX470153.3. On Oct 23, 2007 this sequence version replaced NM_153105.6. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
culus claudin 2 (Cldn2), transcript variant 1, mRNA. ACCESSION NM_016675 VERSION NM_016675.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced NM_016675.4. Summary: This gene encodes a member of the claudin family. Claudins are...
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced XM_006528490.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160099.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160098.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160097.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160096.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC110509.21. On Sep 1, 2022 this sequence version replaced NM_029383.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: 2210404A22Rik; 5330431C14Rik; 9530051B05Rik
NM_029383.2 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_023878.3 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK133810.1 and BE133033.1. On Nov 15, 2007 this sequence version replaced NM_018778.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Mus musculus claudin 18 (Cldn18), transcript variant A2.1, mRNA. ACCESSION NM_001194921 VERSION NM_001194921.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK033657.1, AF349451.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
Mus musculus claudin 18 (Cldn18), transcript variant A2.2, mRNA. ACCESSION NM_001194923 VERSION NM_001194923.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF349453.1, AA028634.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_021386.3. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_021386.4 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced XM_011240673.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced XM_030254750.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
musculus claudin 18 (Cldn18), transcript variant A1.2, mRNA. ACCESSION NM_001194922 VERSION NM_001194922.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB663682.1, AK033657.1, AF349450.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are...
claudin 12 (Cldn12), transcript variant 4, mRNA. ACCESSION NM_001193661 VERSION NM_001193661.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced NM_001193661.1. Summary: This gene encodes a member of the claudin family. Claudin...
claudin 12 (Cldn12), transcript variant 2, mRNA. ACCESSION NM_001193659 VERSION NM_001193659.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced NM_001193659.1. Summary: This gene encodes a member of the claudin family. Claudin...
claudin 12 (Cldn12), transcript variant 3, mRNA. ACCESSION NM_001193660 VERSION NM_001193660.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced NM_001193660.1. Summary: This gene encodes a member of the claudin family. Claudin...
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced NM_022890.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB663682.1, BX528145.1, AF221068.1, AC157949.1 and CF805431.1. On Aug 13, 2010 this sequence version replaced NM_019815.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC154766.2. On Nov 14, 2022 this sequence version replaced XM_006524641.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
claudin 13 (Cldn13), mRNA. ACCESSION NM_020504 VERSION NM_020504.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY079003.1 and AK010869.1. On Aug 11, 2010 this sequence version replaced NM_020504.3. Summary: This gene encodes a member of the claudin family. Claudins...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK008683.1, BB801129.1 and CF545718.1. On Aug 11, 2010 this sequence version replaced NM_021719.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC154766.2. On Nov 14, 2022 this sequence version replaced NM_018777.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
roduct="claudin domain-containing protein 2 isoform 2" /protein_id="NP_001405894.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLLLSACRHDLAEHRSHQRIPGMPMNAACLGQNKGMAFSLAPACFSAERRDRSLETTETRIKWLVES" misc_feature 213..272 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="propagated from UniProtKB/Swiss-Prot (Q9D9H2.1); transmembrane region" misc_feature 243..596 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family...
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK036780.1 and CK626537.1. On Aug 3, 2010 this sequence version replaced NM_016674.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK002672.1 and AV041302.2. On Aug 4, 2010 this sequence version replaced NM_009902.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
product="claudin domain-containing protein 2 isoform 1" /protein_id="NP_083125.1" /db_xref="CCDS:CCDS39929.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPVCL" misc_feature 108..167 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="propagated from UniProtKB/Swiss-Prot (Q9D9H2.1); transmembrane region" misc_feature 138..503 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family;...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145152.1, BC132378.1 and BQ031935.1. On Nov 15, 2007 this sequence version replaced NM_009903.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
DEFINITION Mus musculus claudin 6 (Cldn6), transcript variant 3, mRNA. ACCESSION NM_001439480 VERSION NM_001439480.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC154766.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB872815.1, BC083341.1 and BE627334.1. On Aug 5, 2010 this sequence version replaced NM_013805.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Data Export:
Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.
Debug Info:
Redirect URI : https://ggrna.dbcls.jp/mm/claudin
lang : en |
div : |
spe : mm |
query_string : claudin |
format : html |
download :
0.000 | 0.000 | search_start;
0.098 | 0.098 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Mus musculus (house mouse)?to=0&format=json
0.259 | 0.162 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Mus musculus (house mouse)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.265 | 0.006 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]