LOCUS       NM_009903               1827 bp    mRNA    linear   ROD 19-AUG-2025
DEFINITION  Mus musculus claudin 4 (Cldn4), mRNA.
ACCESSION   NM_009903
VERSION     NM_009903.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1827)
  AUTHORS   Xu,M., Zheng,Y., Chen,J., Gao,C., Zhu,M., Ma,A., Liang,B., Xu,W.,
            Fan,J., Zhou,H., Ke,A. and Shen,Y.
  TITLE     CLDN4 palmitoylation promotes hepatic-to-biliary lineage transition
            and lenvatinib resistance in hepatocellular carcinoma
  JOURNAL   Cell Rep Med 6 (7), 102208 (2025)
   PUBMED   40592346
REFERENCE   2  (bases 1 to 1827)
  AUTHORS   Mak,S. and Hammes,A.
  TITLE     Canonical and Non-Canonical Localization of Tight Junction Proteins
            during Early Murine Cranial Development
  JOURNAL   Int J Mol Sci 25 (3), 1426 (2024)
   PUBMED   38338705
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1827)
  AUTHORS   Okamoto,E., Matsuda,S., Yoshino,Y., Morikawa,Y., Suenami,K.,
            Tabuchi,Y., Matsunaga,T., Hayashi,H. and Ikari,A.
  TITLE     Increase in Paracellular Leakage of Amino Acids Mediated by
            Aging-Induced Reduction of Claudin-4 Expression
  JOURNAL   J Nutr 153 (12), 3360-3372 (2023)
   PUBMED   37806357
  REMARK    GeneRIF: Increase in Paracellular Leakage of Amino Acids Mediated
            by Aging-Induced Reduction of Claudin-4 Expression.
REFERENCE   4  (bases 1 to 1827)
  AUTHORS   Fang,J., Wu,X., He,J., Zhang,H., Chen,X., Zhang,H., Novakovic,B.,
            Qi,H. and Yu,X.
  TITLE     RBM15 suppresses hepatic insulin sensitivity of offspring of
            gestational diabetes mellitus mice via m6A-mediated regulation of
            CLDN4
  JOURNAL   Mol Med 29 (1), 23 (2023)
   PUBMED   36803098
  REMARK    GeneRIF: RBM15 suppresses hepatic insulin sensitivity of offspring
            of gestational diabetes mellitus mice via m6A-mediated regulation
            of CLDN4.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1827)
  AUTHORS   Sato,K., Matsumoto,I., Suzuki,K., Tamura,A., Shiraishi,A.,
            Kiyonari,H., Kasamatsu,J., Yamamoto,H., Miyasaka,T., Tanno,D.,
            Miyahara,A., Zong,T., Kagesawa,T., Oniyama,A., Kawamura,K.,
            Kitai,Y., Umeki,A., Kanno,E., Tanno,H., Ishii,K., Tsukita,S. and
            Kawakami,K.
  TITLE     Deficiency of lung-specific claudin-18 leads to aggravated
            infection with Cryptococcus deneoformans through dysregulation of
            the microenvironment in lungs
  JOURNAL   Sci Rep 11 (1), 21110 (2021)
   PUBMED   34702961
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1827)
  AUTHORS   Itoh,M., Furuse,M., Morita,K., Kubota,K., Saitou,M. and Tsukita,S.
  TITLE     Direct binding of three tight junction-associated MAGUKs, ZO-1,
            ZO-2, and ZO-3, with the COOH termini of claudins
  JOURNAL   J Cell Biol 147 (6), 1351-1363 (1999)
   PUBMED   10601346
REFERENCE   7  (bases 1 to 1827)
  AUTHORS   Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
REFERENCE   8  (bases 1 to 1827)
  AUTHORS   Perez Jurado,L.A., Wang,Y.K., Francke,U. and Cruces,J.
  TITLE     TBL2, a novel transducin family member in the WBS deletion:
            characterization of the complete sequence, genomic structure,
            transcriptional variants and the mouse ortholog
  JOURNAL   Cytogenet Cell Genet 86 (3-4), 277-284 (1999)
   PUBMED   10575226
REFERENCE   9  (bases 1 to 1827)
  AUTHORS   Paperna,T., Peoples,R., Wang,Y.K., Kaplan,P. and Francke,U.
  TITLE     Genes for the CPE receptor (CPETR1) and the human homolog of RVP1
            (CPETR2) are localized within the Williams-Beuren syndrome deletion
  JOURNAL   Genomics 54 (3), 453-459 (1998)
   PUBMED   9878248
REFERENCE   10 (bases 1 to 1827)
  AUTHORS   Katahira,J., Sugiyama,H., Inoue,N., Horiguchi,Y., Matsuda,M. and
            Sugimoto,N.
  TITLE     Clostridium perfringens enterotoxin utilizes two structurally
            related membrane proteins as functional receptors in vivo
  JOURNAL   J Biol Chem 272 (42), 26652-26658 (1997)
   PUBMED   9334247
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK145152.1, BC132378.1 and
            BQ031935.1.
            
            On Nov 15, 2007 this sequence version replaced NM_009903.1.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The protein encoded by this gene is a
            high-affinity receptor for clostridium perfringens enterotoxin
            (CPE) produced by the bacterium Clostridium perfringens, and the
            interaction with CPE results in increased membrane permeability by
            forming small pores in plasma membrane. This protein augments
            alveolar epithelial barrier function and is induced in acute lung
            injury. It is highly expressed in pancreatic and ovarian cancers.
            [provided by RefSeq, Aug 2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-73                AK145152.1         2-74
            74-1253             BC132378.1         1-1180
            1254-1653           AK145152.1         1255-1654
            1654-1827           BQ031935.1         1-174               c
FEATURES             Location/Qualifiers
     source          1..1827
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 74.9 cM"
     gene            1..1827
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="claudin 4"
                     /db_xref="GeneID:12740"
                     /db_xref="MGI:MGI:1313314"
     exon            1..1812
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    184..186
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="upstream in-frame stop codon"
     CDS             190..822
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="CPE-R; CPE-receptor; clostridium perfringens
                     enterotoxin receptor"
                     /codon_start=1
                     /product="claudin-4"
                     /protein_id="NP_034033.1"
                     /db_xref="CCDS:CCDS19728.1"
                     /db_xref="GeneID:12740"
                     /db_xref="MGI:MGI:1313314"
                     /translation="

MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGLLCCSCPPRSNDKPYSAKYSAARSVPASNYV"

     misc_feature    190..498
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="propagated from UniProtKB/Swiss-Prot (O35054.1);
                     Region: Interaction with EPHA2.
                     /evidence=ECO:0000250|UniProtKB:O14493"
     misc_feature    199..699
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    211..273
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="propagated from UniProtKB/Swiss-Prot (O35054.1);
                     transmembrane region"
     misc_feature    433..495
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="propagated from UniProtKB/Swiss-Prot (O35054.1);
                     transmembrane region"
     misc_feature    538..600
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="propagated from UniProtKB/Swiss-Prot (O35054.1);
                     transmembrane region"
     misc_feature    670..732
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="propagated from UniProtKB/Swiss-Prot (O35054.1);
                     transmembrane region"
     misc_feature    814..819
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="propagated from UniProtKB/Swiss-Prot (O35054.1);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000269|PubMed:10601346"
     misc_feature    814..816
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="Phosphotyrosine, by EPHA2.
                     /evidence=ECO:0000250|UniProtKB:O14493; propagated from
                     UniProtKB/Swiss-Prot (O35054.1); phosphorylation site"
     regulatory      1787..1792
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="hexamer: AATAAA"
     polyA_site      1812
                     /gene="Cldn4"
                     /gene_synonym="Cep-r; Cpetr; Cpetr1"
                     /note="major polyA site"
ORIGIN      

ctttcttgttgcaggtgcaggcaggaaagagctgcagtgttcgcgcttggtagctggtgcatcggactcagctggctttgtgtccctgaggctcaccgaaaaaaactttctcagccctctgactccagagagagagagagagaggtactttttgtggtcaccgactttgacccctgcagaggctgagcgatggcgtctatgggactacaggtcctgggaatctccttggcagtcctgggctggctggggatcatcctgagttgtgcgctccccatgtggcgggtgaccgccttcatcggcagcaacatcgtcacggcacagaccagctgggagggcctctggatgaactgcgtggtgcagagcacaggtcagatgcagtgcaagatgtacgactcgatgctcgccctgccgcaggacctgcaggccgcccgagcccttatggtcatcagcatcatcgtgggtgctctggggatgcttctctcagtggtagggggcaagtgcaccaactgcatggaggacgagaccgtcaaggccaagatcatgatcaccgccggagccgtgttcatcgtggcaagcatgctgattatggtgcccgtgtcctggaccgctcacaacgtcatccgcgacttctacaaccctatggtggcttccgggcagaagagggaaatgggggcctcgctttacgtcggctgggcggcctccgggctgctgctcctgggaggaggcctcctctgctgcagttgcccacctcgtagcaacgacaagccctactcggccaagtactccgccgcccgctctgtccccgccagcaactatgtgtaaggtgggccactctgtccacattgcctttgttatctttttttcggattgagctcataacagcctgtggcccctcacattctccaggacctgccctgctatgggccactaactgcttgctggggacaggcaaacccggactgtgcaaagttactagcccgtagctcttgggctgctccacatggctccttacggccggcaagaatggatgtaaaaatatcttgctgcttacatccaaattgctggtggatatggggctgaaggcagaagcagctgggaagggcagtagaggcgcaagctgggtcctgctggccggggtagctcagctgtgactttggactctggagtggatgtcctcatgttagcaaacgtccactgtcctttctctatccccctcactcagcctacacgttactccagcgctactcttgccattacgccccgtgtttccgagcacagctggtcctaccccaagtcatggtgtgctgagtgactgactgaggggccattgagagccggtgggctctgccatggaacccttccgttgattagcaatgactgtgcttgacccacccacctaccctactaatgaatttctgtagagtggatggacgggtttgagggaagaagggtggaggtggattaaactggtttggggagggctggggacctagaagcagcccagtgtgtccccaccccttttccgcactgtcttgctaatgttctgatcactgtgcgccccctccctcttcagaaggaccctgggcctcttgagttggcccctctgagttccctccctttgcccatttcaaggacaccggccagtctgcggaaggaaggtacggggggggggggggggggtgatggcattgtaccagggagtctcctggactcccctgccttctctgtggtttcttgttttgtaatttaaggtctgttcacagctgtaattattattattttctacaataaatggcacctgcatacaggaaaaaaaaaaaaaaaaaa

//