GGRNA ver.2 Help | Advanced search | English    旧バージョン

2021-10-17 16:17:52, GGRNA : RefSeq release 207 (Jul, 2021)




Rattus norvegicus claudin 4 (Cldn4), mRNA. (1824 bp)
gene="Cldn4" /note="upstream in-frame stop codon" CDS 192..824 /gene="Cldn4" /codon_start=1 /product="claudin-4" /protein_id="NP_001012022.1" /db_xref="GeneID:304407" /db_xref="RGD:1307932" /translation="MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV" misc_feature 201..701 /gene="Cldn4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 1438..1594 /gene="Cldn4" /standard_name="...
NM_001012022.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 20 (Cldn20), mRNA. (660 bp)
CDS 1..660 /gene="Cldn20" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001102864.1" /db_xref="GeneID:680178" /db_xref="RGD:1595446" /translation="MASAGLQLLAFILAVSGVSGVLAATLLPNWKVNADAGSTIVTAIVQVHGLWMDCTWYSTGMFSCTLKYSILSLPVYVQAARATMVLACILSALGICTAIVGMKCTHLGGDAHTKSHISFAGGVCFITAGISALIPTVWYTKEIISNFLDLTVPESHKYEPGGAVYIGFISAMLLLIAGIIFCISYIKKNQEPWIYPPKQRLTSTWQPKNRLAYNLKDYV" sig_peptide 1..69 /gene="Cldn20" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 13..543 /gene="Cldn20" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001109394.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 24 (Cldn24), mRNA. (663 bp)
note="claudin 24" /db_xref="GeneID:502083" /db_xref="RGD:1562043" CDS 1..663 /gene="Cldn24" /gene_synonym="RGD1562043" /note="claudin 22 like" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001103614.1" /db_xref="GeneID:502083" /db_xref="RGD:1562043" /translation="MAFIFKTAMQSVALSLSLLGWVLAITTTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGLCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHSSYLENGTAQPKV" misc_feature 19..540 /gene="Cldn24" /gene_synonym="RGD1562043" /note="PMP-22/EMP/MP20/Claudin...
Synonym: RGD1562043
NM_001110144.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 17 (Cldn17), mRNA. (1177 bp)
note="claudin 17" /db_xref="GeneID:304125" /db_xref="RGD:1307462" misc_feature 128..130 /gene="Cldn17" /note="upstream in-frame stop codon" CDS 140..814 /gene="Cldn17" /codon_start=1 /product="claudin-17" /protein_id="NP_001100582.1" /db_xref="GeneID:304125" /db_xref="RGD:1307462" /translation="MAFYPVQIAGLVLGFFGLVGTVGTTLLPQWRVSAFIGSNIIIFERIWEGLWMNCIQQAMVTLQCKFYNSILALPPVLEAARALMCVAMALSLVALIIGICGMKQIECTSSSERVKAYLLGTSGVLFIVTGIFVLIPVSWTANIIIRDFYDPTIHAGQKRELGGALFLGWATAAVLFIAGGLLCGYCCCNRKEQWHGYPVSAYRVPPKDSQRKVTVPRKTSTSYV" misc_feature 155..685 /gene="Cldn17" /note="PMP-22/EMP/MP20/Claudin family;...
NM_001107112.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 8 (Cldn8), mRNA. (2285 bp)
map="11q11" gene 1..2285 /gene="Cldn8" /note="claudin 8" /db_xref="GeneID:304124" /db_xref="RGD:1308575" CDS 3..680 /gene="Cldn8" /codon_start=1 /product="claudin-8" /protein_id="NP_001032863.1" /db_xref="GeneID:304124" /db_xref="RGD:1308575" /translation="MATYALQMAALVLGGVGMVGTVAVTIMPQWRVSAFIESNIVVFENRWEGLWMNCMRHANIRMQCKVYDSLLALSPDLQASRGLMCAASVLSFLAFMTAILGMKCTRCTGEDENVKSRILLTAGIIFFITGLVVLIPVSWVANAIIRDFYNPLVDVAQKRELGEALYIGWTTALVLIAGGALFCCVFCCTERSNSYKYSVPSHRTTQRSFHAEKRSPSIYSKSQYV" misc_feature 15..548 /gene="Cldn8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="...
NM_001037774.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 22 (Cldn22), mRNA. (1010 bp)
map="16q11" gene 1..1010 /gene="Cldn22" /note="claudin 22" /db_xref="GeneID:306454" /db_xref="RGD:1305271" CDS 48..710 /gene="Cldn22" /codon_start=1 /product="claudin-22" /protein_id="NP_001103613.1" /db_xref="GeneID:306454" /db_xref="RGD:1305271" /translation="MGLVFRTATQSAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHQQHLELKQANPEV" misc_feature <192..596 /gene="Cldn22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
NM_001110143.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 34A (Cldn34a), mRNA. (636 bp)
LOCUS NM_001109366 636 bp mRNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus claudin 34A (Cldn34a), mRNA. ACCESSION NM_001109366 XM_001064790 XM_001068935 VERSION NM_001109366.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH474014.2. On or before Oct 4, 2007...
NM_001109366.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 34D (Cldn34d), mRNA. (1008 bp)
LOCUS NM_001109402 1008 bp mRNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus claudin 34D (Cldn34d), mRNA. ACCESSION NM_001109402 XM_001056879 VERSION NM_001109402.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473966.2. On Oct 4, 2007 this sequence version...
NM_001109402.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 23 (Cldn23), mRNA. (1739 bp)
NM_001033062.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 10 (Cldn10), mRNA. (1331 bp)
NM_001106058.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 34E (Cldn34e), mRNA. (639 bp)
LOCUS NM_001109415 639 bp mRNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus claudin 34E (Cldn34e), mRNA. ACCESSION NM_001109415 XM_001057406 VERSION NM_001109415.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from CH473966.2. On Oct 4, 2007 this sequence version...
NM_001109415.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 3 (Cldn3), mRNA. (1501 bp)
stop codon" CDS 441..1100 /gene="Cldn3" /note="RVP1; ventral prostate.1 protein" /codon_start=1 /product="claudin-3" /protein_id="NP_113888.2" /db_xref="GeneID:65130" /db_xref="RGD:68425" /translation="MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALLCCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV" misc_feature 447..941 /gene="Cldn3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" misc_feature 465..527 /gene="Cldn3" /note="...
NM_031700.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 2 (Cldn2), mRNA. (3052 bp)
CDS 349..1041 /gene="Cldn2" /gene_synonym="RGD1560247" /codon_start=1 /product="claudin-2" /protein_id="NP_001100316.1" /db_xref="GeneID:300920" /db_xref="RGD:1560247" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV" misc_feature 361..891 /gene="Cldn2" /gene_synonym="RGD1560247" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" STS 349..1041 /gene="Cldn2" /...
Synonym: RGD1560247
NM_001106846.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 5 (Cldn5), mRNA. (1442 bp)
gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" exon 1..1427 /gene="Cldn5" /inference="alignment:Splign:2.1.0" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV" misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_031701.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 1 (Cldn1), mRNA. (3223 bp)
gene="Cldn1" /note="claudin 1" /db_xref="GeneID:65129" /db_xref="RGD:68422" exon 1..402 /gene="Cldn1" /inference="alignment:Splign:2.1.0" CDS 180..815 /gene="Cldn1" /codon_start=1 /product="claudin-1" /protein_id="NP_113887.3" /db_xref="GeneID:65129" /db_xref="RGD:68422" /translation="MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFVISGLATLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV" misc_feature 192..725 /gene="Cldn1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_031699.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 9 (Cldn9), mRNA. (1432 bp)
gene="Cldn9" /note="upstream in-frame stop codon" CDS 364..1017 /gene="Cldn9" /codon_start=1 /product="claudin-9" /protein_id="NP_001011889.1" /db_xref="GeneID:287099" /db_xref="RGD:1308999" /translation="MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 373..852 /gene="Cldn9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN // REFERENCE 1 (bases 1 to 1432) AUTHORS...
NM_001011889.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 11 (Cldn11), mRNA. (1848 bp)
CDS 196..819 /gene="Cldn11" /codon_start=1 /product="claudin-11" /protein_id="NP_445909.2" /db_xref="GeneID:84588" /db_xref="RGD:71081" /translation="MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSGDAQSFGENRFYYSSGSSSPTHAKSAHV" misc_feature 199..261 /gene="Cldn11" /note="propagated from UniProtKB/Swiss-Prot (Q99P82.1); transmembrane region" misc_feature 211..711 /gene="Cldn11" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_053457.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 15 (Cldn15), mRNA. (684 bp)
gene="Cldn15" /codon_start=1 /product="claudin-15" /protein_id="NP_001100605.1" /db_xref="GeneID:304388" /db_xref="RGD:1310678" /translation="MSIAVETFGFFMSALGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLALSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNIDLSRKAKLLAIAGAFHILAGACGMVAISWYAVNITTDFFNPLYVGTKYELGSALYLGWSASLLSILGGICVFSTCCCDSKEDPATRVGLPYKPSTVVTARATSDESDVSFGKYGKNAYV" misc_feature 4..72 /gene="Cldn15" /note="propagated from UniProtKB/Swiss-Prot (D3ZQJ0.1); transmembrane region" misc_feature 10..531 /gene="Cldn15" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="...
NM_001107135.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 19 (Cldn19), mRNA. (1626 bp)
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-19
NM_001008514.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 19 (Cldn19), transcript variant X1, mRNA. (3577 bp)
xref="RGD:1305000" CDS 413..1087 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19 isoform X1" /protein_id="XP_006238818.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLSTSVKGPLGV" misc_feature 422..958 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
Synonym: claudin-19
XM_006238756.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 18 (Cldn18), mRNA. (1574 bp)
note="claudin 18-like" /codon_start=1 /product="claudin-18 precursor" /protein_id="NP_001014118.1" /db_xref="GeneID:315953" /db_xref="RGD:1359696" /translation="MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLTSGIMFIISGVCAIIGVSVFANMLVTNFWMSTANMYSGMGGMVQTVQTRYTFGAALFVGWIAGGLTLIGGVMMCIACRGLTPDDRNFKAVSYHASGQNVAYKPGGFKASTGFGSNARNKKIYDGGARTEDDEQSHPTKYDYV" sig_peptide 33..101 /gene="Cldn18" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature <159..605 /gene="Cldn18" /note="PMP-22/EMP/MP20/Claudin family;...
NM_001014096.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 6 (Cldn6), mRNA. (1544 bp)
CDS 132..791 /gene="Cldn6" /codon_start=1 /product="claudin-6 precursor" /protein_id="NP_001095834.1" /db_xref="GeneID:287098" /db_xref="RGD:1308837" /translation="MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLIVLLGLLLYLAGAKCTTCVEDKNSKSRLVLISGVIFVISGVLTLIPICWTAHAIIQDFYNPLVADAQKRELGASLYLGWAASGLLLIGGGLLCCACSSGGTQGPSHYVARYSSPVPHSRGPSEYPSKNYV" sig_peptide 132..194 /gene="Cldn6" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 141..641 /gene="Cldn6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001102364.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 14 (Cldn14), mRNA. (1549 bp)
note="upstream in-frame stop codon" CDS 481..1200 /gene="Cldn14" /codon_start=1 /product="claudin-14" /protein_id="NP_001013447.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 547..1023 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" STS 507..751 /gene="Cldn14" /...
NM_001013429.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 10 (Cldn10), transcript variant X4, mRNA. (743 bp)
by RNAseq alignments" /db_xref="GeneID:290485" /db_xref="RGD:1308027" CDS 1..525 /gene="Cldn10" /codon_start=1 /product="claudin-10 isoform X4" /protein_id="XP_038949129.1" /db_xref="GeneID:290485" /db_xref="RGD:1308027" /translation="MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGVVFILSGLCSMTGCSLYANKITTEFFDPLFMEQKMGYTYNGPTSVMSSRTKYQGGEGDFKTTGPSKQFDKNAYV" misc_feature 25..417 /gene="Cldn10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_039093201.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 10 (Cldn10), transcript variant X2, mRNA. (800 bp)
alignments" /db_xref="GeneID:290485" /db_xref="RGD:1308027" CDS 1..582 /gene="Cldn10" /codon_start=1 /product="claudin-10 isoform X2" /protein_id="XP_038949127.1" /db_xref="GeneID:290485" /db_xref="RGD:1308027" /translation="MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVEGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGVVFILSGLCSMTGCSLYANKITTEFFDPLFMEQKMGYTYNGPTSVMSSRTKYQGGEGDFKTTGPSKQFDKNAYV" misc_feature 25..474 /gene="Cldn10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_039093199.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 10 (Cldn10), transcript variant X3, mRNA. (881 bp)
annotated introns" /db_xref="GeneID:290485" /db_xref="RGD:1308027" CDS 139..663 /gene="Cldn10" /codon_start=1 /product="claudin-10 isoform X3" /protein_id="XP_038949128.1" /db_xref="GeneID:290485" /db_xref="RGD:1308027" /translation="MALSSPPPLILPTCGRCYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGVVFILSGLCSMTGCSLYANKITTEFFDPLFMEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRMGYTYNGPTSVMSSRTKYQGGEGDFKTTGPSKQFDKNAYV" misc_feature <190..504 /gene="Cldn10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_039093200.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 18 (Cldn18), transcript variant X1, mRNA. (2561 bp)
db_xref="GeneID:315953" /db_xref="RGD:1359696" CDS 112..708 /gene="Cldn18" /codon_start=1 /product="claudin-18 isoform X1" /protein_id="XP_038937476.1" /db_xref="GeneID:315953" /db_xref="RGD:1359696" /translation="MCASRGRFVIAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLTSGIMFIISGVCAIIGVSVFANMLVTNFWMSTANMYSGMGGMVQTVQTRYTFGAALFVGWIAGGLTLIGGVMMCIACRGLTPDDRNFKAVSYHASGQNVAYKPGGFKASTGFGSNARNKKIYDGGARTEDDEQSHPTKYDYV" misc_feature <148..495 /gene="Cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_039081548.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 7 (Cldn7), transcript variant X1, mRNA. (877 bp)
GeneID:65132" /db_xref="RGD:68432" CDS 152..694 /gene="Cldn7" /gene_synonym="cld-7" /codon_start=1 /product="claudin-7 isoform X1" /protein_id="XP_038942733.1" /db_xref="GeneID:65132" /db_xref="RGD:68432" /translation="MSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALPAATQATRALMIVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMTGGIIFIVAGLAALVACSWIGHQIVTDFYNPLTPMNIKYEFGPAIFIGWAGSALVLLGGALLSCSCPGSESKAAYRAPRSYPKSNSSKEYV" misc_feature 152..571 /gene="Cldn7" /gene_synonym="cld-7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
Synonym: cld-7
XM_039086805.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 10 (Cldn10), transcript variant X1, mRNA. (908 bp)
GeneID:290485" /db_xref="RGD:1308027" CDS 1..690 /gene="Cldn10" /codon_start=1 /product="claudin-10 isoform X1" /protein_id="XP_006252512.1" /db_xref="GeneID:290485" /db_xref="RGD:1308027" /translation="MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVEGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGVVFILSGLCSMTGCSLYANKITTEFFDPLFMEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRMGYTYNGPTSVMSSRTKYQGGEGDFKTTGPSKQFDKNAYV" misc_feature 25..531 /gene="Cldn10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_006252450.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 14 (Cldn14), transcript variant X1, mRNA. (1468 bp)
db_xref="RGD:1309165" CDS 535..1254 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_038944338.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 601..1077 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_039088410.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 6 (Cldn6), transcript variant X1, mRNA. (1940 bp)
xref="GeneID:287098" /db_xref="RGD:1308837" CDS 525..1184 /gene="Cldn6" /codon_start=1 /product="claudin-6 isoform X1" /protein_id="XP_008765733.1" /db_xref="GeneID:287098" /db_xref="RGD:1308837" /translation="MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLIVLLGLLLYLAGAKCTTCVEDKNSKSRLVLISGVIFVISGVLTLIPICWTAHAIIQDFYNPLVADAQKRELGASLYLGWAASGLLLIGGGLLCCACSSGGTQGPSHYVARYSSPVPHSRGPSEYPSKNYV" misc_feature 534..1034 /gene="Cldn6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_008767511.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 2 (Cldn2), transcript variant X2, mRNA. (1520 bp)
CDS 407..1093 /gene="Cldn2" /gene_synonym="RGD1560247" /codon_start=1 /product="claudin-2 isoform X2" /protein_id="XP_038955509.1" /db_xref="GeneID:300920" /db_xref="RGD:1560247" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTG" misc_feature 419..949 /gene="Cldn2" /gene_synonym="RGD1560247" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
Synonym: RGD1560247
XM_039099581.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 14 (Cldn14), transcript variant X3, mRNA. (1359 bp)
db_xref="RGD:1309165" CDS 426..1145 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_006248120.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 492..968 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_006248058.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 14 (Cldn14), transcript variant X2, mRNA. (1219 bp)
db_xref="RGD:1309165" CDS 286..1005 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_006248121.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 352..828 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_006248059.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 15 (Cldn15), transcript variant X1, mRNA. (3397 bp)
GeneID:304388" /db_xref="RGD:1310678" CDS 1585..2268 /gene="Cldn15" /codon_start=1 /product="claudin-15 isoform X1" /protein_id="XP_006249217.1" /db_xref="GeneID:304388" /db_xref="RGD:1310678" /translation="MSIAVETFGFFMSALGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLALSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNIDLSRKAKLLAIAGAFHILAGACGMVAISWYAVNITTDFFNPLYVGTKYELGSALYLGWSASLLSILGGICVFSTCCCDSKEDPATRVGLPYKPSTVVTARATSDESDVSFGKYGKNAYV" misc_feature 1594..2115 /gene="Cldn15" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_006249155.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 7 (Cldn7), mRNA. (1215 bp)
cld-7" /codon_start=1 /product="claudin-7 precursor" /protein_id="NP_113890.1" /db_xref="GeneID:65132" /db_xref="RGD:68432" /translation="MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALPAATQATRALMIVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMTGGIIFIVAGLAALVACSWIGHQIVTDFYNPLTPMNIKYEFGPAIFIGWAGSALVLLGGALLSCSCPGSESKAAYRAPRSYPKSNSSKEYV" sig_peptide 400..471 /gene="Cldn7" /gene_synonym="cld-7" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 409..912 /gene="Cldn7" /gene_synonym="cld-7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /...
Synonym: cld-7
NM_031702.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 12 (Cldn12), mRNA. (3480 bp)
M, Deutsch U and Engelhardt B. CONSRTM German Mouse Clinic Consortium TITLE Claudin-12 is not required for blood-brain barrier tight junction function JOURNAL Fluids Barriers CNS 16 (1), 30 (2019) PUBMED 31511021 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 3480) AUTHORS Berndt P, Winkler L, Cording J, Breitkreuz-Korff O, Rex A, Dithmer S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE and Haseloff RF. TITLE Tight junction proteins at the blood-brain barrier: far more than claudin-5 JOURNAL Cell. Mol. Life Sci. 76 (10), 1987-2002 (2019) PUBMED 30734065...
Synonym: RGD1561053
NM_001100813.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 2 (Cldn2), transcript variant X1, mRNA. (3094 bp)
CDS 406..1098 /gene="Cldn2" /gene_synonym="RGD1560247" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006234324.1" /db_xref="GeneID:300920" /db_xref="RGD:1560247" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV" misc_feature 418..948 /gene="Cldn2" /gene_synonym="RGD1560247" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
Synonym: RGD1560247
XM_006234262.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin domain containing 1 (Cldnd1), transcript variant X1, mRNA. (2127 bp)
RGD:1359273" CDS 193..954 /gene="Cldnd1" /codon_start=1 /product="claudin domain-containing protein 1 isoform X1" /protein_id="XP_006248266.2" /db_xref="GeneID:288182" /db_xref="RGD:1359273" /translation="MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYQSPAQENSSDANRIAWEDFMGDEADEKTYNDALFRYNGNLGLWRRCITIPKNTHWYAPPERTESFEVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACVCRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLGLPKNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA" misc_feature 241..894 /gene="Cldnd1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_006248204.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin domain containing 1 (Cldnd1), transcript variant X2, mRNA. (2073 bp)
XM_006248206.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin domain containing 2 (Cldnd2), mRNA. (745 bp)
alignment:Splign:2.0.8" CDS 119..622 /gene="Cldnd2" /gene_synonym="RGD1566413" /codon_start=1 /product="claudin domain-containing protein 2" /protein_id="NP_001102613.1" /db_xref="GeneID:499140" /db_xref="RGD:1566413" /translation="MGVKKSLQTGGNLLNLLSSVLTVLSTTTSYWIRQQGGHSGLWQECTHGVCSNMPCQNTLAVTTACMVLAAAFSIVALGMGIRIQCQEAESLRSQNTIVLLFLSGLLLLIALTVYTAKNAWKPEVFFSWSYFFGWLALPFSFIAGFCFLLADMIMQSTEAISGFPVCL" misc_feature 185..550 /gene="Cldnd2" /gene_synonym="RGD1566413" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 288..428 /gene="Cldnd2" /gene_synonym...
Synonym: RGD1566413
NM_001109143.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin-4-like (LOC103691506), mRNA. (588 bp)
db_xref="GeneID:103691506" /db_xref="RGD:9242288" CDS 1..588 /gene="LOC103691506" /codon_start=1 /product="claudin-4-like" /protein_id="XP_008767408.1" /db_xref="GeneID:103691506" /db_xref="RGD:9242288" /translation="MASLGQQAVIEFSGSDIIRQSTIWKGLWKSCVAQEGHQTQCKAYDSLLGRPESWQKSRVLMVTCIITAGLGLLLCVVRSKCLKCVEEENTKAKIRMGAGALCLLAGLLVTVSVSWVTHDIMQGFSSRLIPSVQKGKMGAVLYIGWASSGLLLLGGPLLSCNCSPLTDRRHSVRYQAASSSIVCNSGLNPPNAATL" misc_feature <64..438 /gene="LOC103691506" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_008769186.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 34B (Cldn34b), mRNA. (1135 bp)
db_xref="GeneID:680342" /db_xref="RGD:1592987" CDS 260..886 /gene="Cldn34b" /codon_start=1 /product="claudin-34" /protein_id="XP_001056750.2" /db_xref="GeneID:680342" /db_xref="RGD:1592987" /translation="MLMKNCHHQMGGFALTTVAWLLCCISIGLPQWQVWHYEDPVILKPTVAFVGIWRTCIFHTDSNSSNNRLCHQYSYRDSFVPLYIRINQHLLLVSSFLGLFGKITTIIALSNVSMGRVRRNATCNPFSLSGILNIIASSFLYLAVLFNYIAIVRKWRVSFPPSFHMPSHPHTQKMGSAMALAIIAAVFFLLSGTICLSSNLGKSPHSKI" misc_feature 311..850 /gene="Cldn34b" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_001056750.5 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 34D (Cldn34d), transcript variant X3, mRNA. (875 bp)
LOCUS XM_039100060 875 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus claudin 34D (Cldn34d), transcript variant X3, mRNA. ACCESSION XM_039100060 VERSION XM_039100060.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_039100060.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 34A (Cldn34a), transcript variant X1, mRNA. (3973 bp)
LOCUS XM_039099990 3973 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus claudin 34A (Cldn34a), transcript variant X1, mRNA. ACCESSION XM_039099990 VERSION XM_039099990.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_039099990.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 34D (Cldn34d), transcript variant X2, mRNA. (1118 bp)
LOCUS XM_008773232 1118 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus claudin 34D (Cldn34d), transcript variant X2, mRNA. ACCESSION XM_008773232 VERSION XM_008773232.3 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_008773232.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 34D (Cldn34d), transcript variant X1, mRNA. (1079 bp)
LOCUS XM_008773231 1079 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus claudin 34D (Cldn34d), transcript variant X1, mRNA. ACCESSION XM_008773231 VERSION XM_008773231.3 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_008773231.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin domain containing 2 (Cldnd2), transcript variant X1, mRNA. (1162 bp)
LOCUS XM_039087376 1162 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus claudin domain containing 2 (Cldnd2), transcript variant X1, mRNA. ACCESSION XM_039087376 VERSION XM_039087376.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
Synonym: RGD1566413
XM_039087376.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin domain containing 1 (Cldnd1), mRNA. (2145 bp)
Splign:2.1.0" CDS 211..972 /gene="Cldnd1" /codon_start=1 /product="claudin domain-containing protein 1" /protein_id="NP_001006956.2" /db_xref="GeneID:288182" /db_xref="RGD:1359273" /translation="MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYQSPAQENSSDANRIAWEDFMGDEADEKTYNDALFRYNGNLGLWRRCITIPKNTHWYAPPERTESFEVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACVCRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLGLPKNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA" misc_feature 259..912 /gene="Cldnd1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 503..613 /gene...
NM_001006955.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 12 (Cldn12), transcript variant X2, mRNA. (3676 bp)
LOCUS XM_006236053 3676 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus claudin 12 (Cldn12), transcript variant X2, mRNA. ACCESSION XM_006236053 VERSION XM_006236053.4 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: RGD1561053
XM_006236053.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)

Data Export:


Debug Info:

Redirect URI :
lang : ja | div : | spe : rn | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.075 | 0.075 | count_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Rattus norvegicus (Norway rat)?to=0&format=json
0.129 | 0.054 | search_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Rattus norvegicus (Norway rat)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.134 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]