GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-29 20:19:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001398571             735 bp    mRNA    linear   ROD 12-JUN-2023
DEFINITION  Rattus norvegicus claudin 25 (Cldn25), mRNA.
ACCESSION   NM_001398571 XM_002729920
VERSION     NM_001398571.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 735)
  AUTHORS   Berndt P, Winkler L, Cording J, Breitkreuz-Korff O, Rex A, Dithmer
            S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE
            and Haseloff RF.
  TITLE     Tight junction proteins at the blood-brain barrier: far more than
            claudin-5
  JOURNAL   Cell Mol Life Sci 76 (10), 1987-2002 (2019)
   PUBMED   30734065
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from JACYVU010000198.1.
            
            On Dec 20, 2021 this sequence version replaced XM_002729920.5.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on transcript alignments.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-735               JACYVU010000198.1  11205241-11205975   c
FEATURES             Location/Qualifiers
     source          1..735
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="8"
                     /map="8q23"
     gene            1..735
                     /gene="Cldn25"
                     /note="claudin 25"
                     /db_xref="GeneID:100360390"
                     /db_xref="RGD:2322263"
     exon            1..735
                     /gene="Cldn25"
                     /inference="alignment:Splign:2.1.0"
     CDS             1..690
                     /gene="Cldn25"
                     /codon_start=1
                     /product="putative claudin-25"
                     /protein_id="NP_001385500.1"
                     /db_xref="GeneID:100360390"
                     /db_xref="RGD:2322263"
                     /translation="
MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLNLDLNEMETWVSGLWEACVNQEEAGTVCKSFESFLSLPQELQVARILMVASHGLGLLGLLLSGCGLECFRFHRPRGIFKTRLCLLGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLALGGLLLIFSACLENEEGSSPWTAEATAPPACTPVEEFDGSFHLTPRPVNQVV"
ORIGIN      
atggcctgtagcttccgtgggagagtccagcttggaggtctgctcctctctgtccttggctgggtatgctcctgtgtcaccaccgttcttccccagtggaagactctcaatctggatctgaatgaaatggaaacctgggtctcgggactctgggaggcttgtgtgaatcaggaggaagctggcactgtatgtaaatccttcgagtcctttttgtctctgccccaagagctacaggtagctcgaattctcatggtggcttcccatgggctgggactgttgggacttctgctgtcgggctgtgggttggaatgcttccggtttcacaggcccagaggaattttcaagactcggctgtgcctcctgggagggactttggaagcatcagcttcagccaccaccctctttccagtctcctgggtggcctatgccacattccaagacttctgggatgacagcatccctgaaattgtgccccgatgggagtttggagacgccttgttcctgggctgggctgctgggcttttcctagctctgggtggacttctcctcatcttctctgcttgcctggaaaatgaagagggatcatctccttggacggctgaagccacagccccaccagcctgtactccagtagaggaatttgatggttccttccacctcacaccaagaccagtgaaccaggtcgtctagagctaggatctgcctagaaatctctataataaaggaatgtcagta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]