GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2020-02-27 20:50:31, GGRNA : RefSeq release 98 (Jan, 2020)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Xenopus tropicalis ATPase, Cu++ transporting, beta polypeptide (atp7b), mRNA. (7902 bp)
db_xref="Xenbase:XB-GENE-6044681" /translation="MFPKRILDEEEGVQLLSTENEKCSTKRRSSPQFCVNNTFSDSPVSVWKEAKKPSCAFDNRGYEGSPDDLCSLPDDVGSVVVAIQGMTCQSCVQSIEGRISKVSGVVGINVCLEQNNAIVNYLQTEITPHKICEEIEDMGFDASLSEQSGMPSSVKSSYYGDNVIKIRVEGMTCQSCVNTIEGKIGKIQGVQKIKVSLTGQEAVITYQSHIIQAEDLRKYIEDMGFEASIKNKPDPTKLGTIDIERLQNSIAE...KISGYFVPFIIIISVVTLVTWIIIGFVNFDIIIKYFPSYSKNISKTEVIIRVAFQTSITVLSIACPCALGLATPTAVMVGTGVAAQNGILIKGGEPLEMAHKIKAVMFDKTGTITHGVPKVMRVLLLGDVVKMPLKRMLAVVGTAEASSEHPLGMAVTKYCKEELGTELLGYCTDFQAVPGCGISCKVNNIESVLVQNEEGLNEQNSYRNSLIGTTDSSLIITPELLGAQAPLAHTVLIGNREWMRRNGLHISTDVDEAMSSHEMKGQTAVLVAIDGELCGMIAIADTVKQEAALAVHTL...
AA_position 86 1064
XM_002936732.5 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (4289 bp)
translation="MERAGGEKSGSPEPSFLATLADPQVTLLSVHKRWSFRRSPGARGSIRPVTSEEEGCRPEEGGFSQKVLNGTQEIGSDQILSKLPWTARAWEPEMKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGLIDVRRL...RFSGYFVPFIIIISTLTSVVWIVIGFTDFGVVQKYFPTPNKHISQVEVVFRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDMATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETMGYCTDFQAVPGCGIGCKVSSVEGILAQGERLQSEQTAHLNGVSSVPVETDAAPQTFSVLIGNREWMRRNGLTVTSDVSDAMTDHEMKGQTAILVAIDDCSRPEDSFAPRPGLRSALLALTWGCLLQVCSV...
AA_position 127 1122
XM_031684582.1 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Calypte anna ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (4215 bp)
MIMERKLDNKMKSEVSCLATLNNKNITLVSIRKQQAAHDVPELLIIGEKSKAESPVKASSNSQKEEKLLQSYSMGMPEVNAVERQALSNTDSPPGCELEPTMKQSFAFDNMGYEESFETLLSPSSQEHTMAVRIVGMTCQSCVQSIEGRISKVEGIVSIKVSLEKNNAVIKYLQSEISPEQICQEIQDMGFDANIAEERLTTETLNASCVREAIVKLRVEGMTCQSCATSIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKSHIGNLGYNCTIKSKSAPLKLGVLDLERLQNA...KFSGYFVPFIIIISTVTLIAWITIGFMNFDIIKKYFPKQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAFLSTAEEPLDKMDTGRSGGSTAPLGENALITLSESQAPSSPTYSVLIGNREWMRRNGLQIANDINDAMTDHEMKGQTAILVAIDGVLRGMIAVADTVKQEAALAVHT...
AA_position 137 1126
XM_030464434.1 - Calypte anna (Anna's hummingbird) - NCBI
PREDICTED: Camarhynchus parvulus ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (4410 bp)
X2" /protein_id="XP_030805433.1" /db_xref="GeneID:115904287" /translation="MPGTVFSRRNLRSFIYRALSNIDSPPGCELKPTMKHNFAFDNMGYEASSETMPSPPSQEHIVVLNIVGMTCQSCVQSIEGRISKVKGILRIKVSLEQNNAVIKYRQSEISPEQICQEILDMGFDANIAEEKLTTATVNFPSLKEAVAKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLDNQEAIIVYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALD...KFSGYFVPFIIIISTVTLIAWITIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITYGVPKVMRVLLMGDTAVLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVGGVEAILGTAEEAPNKLDANRTGDSSAPLGDNGVIPLLESQGPSASEKYSVLIGNREWMRRNGLNIANDVNDAMTNHEMKGQTAILAAIDGALCGMIAIADTVKQEAALAVH...
AA_position 69 1058
XM_030949573.1 - Camarhynchus parvulus - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (6544 bp)
copper-transporting ATPase 2 isoform X4" /protein_id="XP_031540441.1" /db_xref="GeneID:102544967" /translation="MKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGL...RFSGYFVPFIIIISTLTSVVWIVIGFTDFGVVQKYFPTPNKHISQVEVVFRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDMATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETMGYCTDFQAVPGCGIGCKVSSVEGILAQGERLQSEQTAHLNGVSSVPVETDAAPQTFSVLIGNREWMRRNGLTVTSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 34 1029
XM_031684581.1 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Calypte anna ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (6241 bp)
transporting ATPase 2 isoform X3" /protein_id="XP_030320286.1" /db_xref="GeneID:103535568" /translation="MKQSFAFDNMGYEESFETLLSPSSQEHTMAVRIVGMTCQSCVQSIEGRISKVEGIVSIKVSLEKNNAVIKYLQSEISPEQICQEIQDMGFDANIAEERLTTETLNASCVREAIVKLRVEGMTCQSCATSIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKSHIGNLGYNCTIKSKSAPLKLGVLDLER...KFSGYFVPFIIIISTVTLIAWITIGFMNFDIIKKYFPKQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAFLSTAEEPLDKMDTGRSGGSTAPLGENALITLSESQAPSSPTYSVLIGNREWMRRNGLQIANDINDAMTDHEMKGQTAILVAIDGVLRGMIAVADTVKQEAALAVHT...
AA_position 36 1025
XM_030464426.1 - Calypte anna (Anna's hummingbird) - NCBI
PREDICTED: Calypte anna ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6318 bp)
transporting ATPase 2 isoform X3" /protein_id="XP_030320279.1" /db_xref="GeneID:103535568" /translation="MKQSFAFDNMGYEESFETLLSPSSQEHTMAVRIVGMTCQSCVQSIEGRISKVEGIVSIKVSLEKNNAVIKYLQSEISPEQICQEIQDMGFDANIAEERLTTETLNASCVREAIVKLRVEGMTCQSCATSIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKSHIGNLGYNCTIKSKSAPLKLGVLDLER...KFSGYFVPFIIIISTVTLIAWITIGFMNFDIIKKYFPKQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAFLSTAEEPLDKMDTGRSGGSTAPLGENALITLSESQAPSSPTYSVLIGNREWMRRNGLQIANDINDAMTDHEMKGQTAILVAIDGVLRGMIAVADTVKQEAALAVHT...
AA_position 36 1025
XM_030464419.1 - Calypte anna (Anna's hummingbird) - NCBI
PREDICTED: Melopsittacus undulatus ATPase copper transporting beta (LOC101881860), transcript variant X3, mRNA. (6280 bp)
isoform X3" /protein_id="XP_030903580.1" /db_xref="GeneID:101881860" /translation="MGMPAVNAVERQALSTTDSPPGFELEPTMKHSFAFDNMGYEDSFETGPSSSSQEHTVAVNIVGMTCQSCVQSIEGRISKVKGIVSIKVSLEQNNAVIKYLKSDISAEQICKEIQDMGFDANIAEERLTTAAVNLSCLKEAVVKLRVEGMTCQSCATNIEGKMRKLHGVAKVKVSLGNQEAIIAYYPYIIQPDDLKNHISNLGYECTIKSKSAPLKLG...ESLITGEAMPVTKKPGSTVIAGSINAHGSVLVNATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADQFSGYFVPFIIIISTVTLIVWITIGFINFDVIQKYFPIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCREELGTQSLGYCTDFQAVPGCGISCKVGGVEAVLDMAEEGLDKLDANRSGDSSAPLGDNMLVMLSESHGPSVSHTYSVLIGNREWMRRNGLHIANDINDAMTDHETKGQTAILVAIDGMLCGMIAIADTVKQEAALAVH...
AA_position 64 986
XM_031047720.1 - Melopsittacus undulatus (budgerigar) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X9, mRNA. (6649 bp)
X6" /protein_id="XP_017806754.3" /db_xref="GeneID:101006616" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIE...AGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGNLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1022
XM_017951265.3 - Papio anubis (olive baboon) - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6485 bp)
ATPase 2 isoform X3" /protein_id="XP_031540440.1" /db_xref="GeneID:102544967" /translation="MQILSKLPWTARAWEPEMKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGLIDV...RFSGYFVPFIIIISTLTSVVWIVIGFTDFGVVQKYFPTPNKHISQVEVVFRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDMATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETMGYCTDFQAVPGCGIGCKVSSVEGILAQGERLQSEQTAHLNGVSSVPVETDAAPQTFSVLIGNREWMRRNGLTVTSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 51 1046
XM_031684580.1 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Gopherus evgoodei ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (4354 bp)
ATPase 2 isoform X3" /protein_id="XP_030420168.1" /db_xref="GeneID:115652357" /translation="MNALSKSSSPATCVQEPTMKQNFAFDNIGYERSAENMPSLLPQTSTITVNILGMTCQSCVQSIEGRISKVKGIVSIKVSLEQSNAVIKYIQSEISPQEVCQEIGDMGFDASIAEARTTASSVRSTSLGEALMKLRVEGMTCQSCVNTIEGKIGKLHGVLRIKVSLSNQEAVIAYQPYIIQPEDLKKHIDNMGYESTIKSKQAPLKLGM...KFSGYFVPFIIIISAVTLLVWITIGFINFDVVQKYFPHQNKHLSKAEVILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRMLLLRDTAKLSLKKVLAIVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVRSVEAVLGQSEQSVNEQNAYLSSVSTISLGHSSSIMVSESDGAAAPLTYSVLIGNREWMRRNGLLISSDVNDAMTGHEMKGQTAILVAIDGALYGMIVIADTVKQEAALAVH...
AA_position 54 1057
XM_030564308.1 - Gopherus evgoodei (Goodes thornscrub tortoise) - NCBI
PREDICTED: Leptonychotes weddellii ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (4626 bp)
copper-transporting ATPase 2 isoform X3" /protein_id="XP_030891632.1" /db_xref="GeneID:102730267" /translation="MKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGP...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVAMMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHGERQQSKQAAPLSRTGSVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 34 1034
XM_031035772.1 - Leptonychotes weddellii (Weddell seal) - NCBI
PREDICTED: Leptonychotes weddellii ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (4639 bp)
copper-transporting ATPase 2 isoform X3" /protein_id="XP_030891633.1" /db_xref="GeneID:102730267" /translation="MKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGP...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVAMMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHGERQQSKQAAPLSRTGSVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 34 1034
XM_031035773.1 - Leptonychotes weddellii (Weddell seal) - NCBI
PREDICTED: Calypte anna ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6471 bp)
isoform X2" /protein_id="XP_030320270.1" /db_xref="GeneID:103535568" /translation="MGMPEVNAVERQALSNTDSPPGCELEPTMKQSFAFDNMGYEESFETLLSPSSQEHTMAVRIVGMTCQSCVQSIEGRISKVEGIVSIKVSLEKNNAVIKYLQSEISPEQICQEIQDMGFDANIAEERLTTETLNASCVREAIVKLRVEGMTCQSCATSIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKSHIGNLGYNCTIKSKSAPLKLG...KFSGYFVPFIIIISTVTLIAWITIGFMNFDIIKKYFPKQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAFLSTAEEPLDKMDTGRSGGSTAPLGENALITLSESQAPSSPTYSVLIGNREWMRRNGLQIANDINDAMTDHEMKGQTAILVAIDGVLRGMIAVADTVKQEAALAVHT...
AA_position 64 1053
XM_030464410.1 - Calypte anna (Anna's hummingbird) - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6836 bp)
X2" /protein_id="XP_031540439.1" /db_xref="GeneID:102544967" /translation="MKPEQERRIIDREEASRRILSKLPWTARAWEPEMKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGLIDVR...RFSGYFVPFIIIISTLTSVVWIVIGFTDFGVVQKYFPTPNKHISQVEVVFRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDMATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETMGYCTDFQAVPGCGIGCKVSSVEGILAQGERLQSEQTAHLNGVSSVPVETDAAPQTFSVLIGNREWMRRNGLTVTSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 67 1062
XM_031684579.1 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Camarhynchus parvulus ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (4593 bp)
MERKLDNKMKKELSYLATLNDRNISLLSIHKQQAARDVPELLIIGEKSKMASPPKASSNLQKEEKLSQSYSMGMTEVSTDERQALSNIDSPPGCELKPTMKHNFAFDNMGYEASSETMPSPPSQEHIVVLNIVGMTCQSCVQSIEGRISKVKGILRIKVSLEQNNAVIKYRQSEISPEQICQEILDMGFDANIAEEKLTTATVNFPSLKEAVAKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLDNQEAIIVYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANP...KFSGYFVPFIIIISTVTLIAWITIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITYGVPKVMRVLLMGDTAVLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVGGVEAILGTAEEAPNKLDANRTGDSSAPLGDNGVIPLLESQGPSASEKYSVLIGNREWMRRNGLNIANDVNDAMTNHEMKGQTAILAAIDGALCGMIAIADTVKQEAALAVH...
AA_position 135 1124
XM_030949564.1 - Camarhynchus parvulus - NCBI
PREDICTED: Melopsittacus undulatus ATPase copper transporting beta (LOC101881860), transcript variant X2, mRNA. (6430 bp)
transporting ATPase 2 isoform X2" /protein_id="XP_030903579.1" /db_xref="GeneID:101881860" /translation="MKHSFAFDNMGYEDSFETGPSSSSQEHTVAVNIVGMTCQSCVQSIEGRISKVKGIVSIKVSLEQNNAVIKYLKSDISAEQICKEIQDMGFDANIAEERLTTAAVNLSCLKEAVVKLRVEGMTCQSCATNIEGKMRKLHGVAKVKVSLGNQEAIIAYYPYIIQPDDLKNHISNLGYECTIKSKSAPLKLGVLDLER...QFSGYFVPFIIIISTVTLIVWITIGFINFDVIQKYFPNQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCREELGTQSLGYCTDFQAVPGCGISCKVGGVEAVLDMAEEGLDKLDANRSGDSSAPLGDNMLVMLSESHGPSVSHTYSVLIGNREWMRRNGLHIANDINDAMTDHETKGQTAILVAIDGMLCGMIAIADTVKQEAALAVH...
AA_position 36 1023
XM_031047719.1 - Melopsittacus undulatus (budgerigar) - NCBI
PREDICTED: Gopherus evgoodei ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6039 bp)
ATPase 2 isoform X2" /protein_id="XP_030420163.1" /db_xref="GeneID:115652357" /translation="MNALSKSSSPATCVQEPTMKQNFAFDNIGYERSAENMPSLLPQTSTITVNILGMTCQSCVQSIEGRISKVKGIVSIKVSLEQSNAVIKYIQSEISPQEVCQEIGDMGFDASIAEARTTASSVRSTSLGEALMKLRVEGMTCQSCVNTIEGKIGKLHGVLRIKVSLSNQEAVIAYQPYIIQPEDLKKHIDNMGYESTIKSKQAPLKLGM...KFSGYFVPFIIIISAVTLLVWITIGFINFDVVQKYFPHQNKHLSKAEVILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRMLLLRDTAKLSLKKVLAIVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVRSVEAVLGQSEQSVNEQNAYLSSVSTISLGHSSSIMVSESDGAAAPLTYSVLIGNREWMRRNGLLISSDVNDAMTGHEMKGQTAILVAIDGALYGMIVIADTVKQEAALAVH...
AA_position 54 1019
XM_030564303.1 - Gopherus evgoodei (Goodes thornscrub tortoise) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X7, mRNA. (6680 bp)
X4" /protein_id="XP_021785338.2" /db_xref="GeneID:101006616" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIE...RFSGYFVPLIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGNLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDAADAGWFTPGVLCGMIAIADAVKQEAALAVHTL...
AA_position 67 1067
XM_021929646.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (6812 bp)
X4" /protein_id="XP_021785336.2" /db_xref="GeneID:101006616" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIE...RFSGYFVPLIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGNLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDAADAGWFTPGVLCGMIAIADAVKQEAALAVHTL...
AA_position 67 1067
XM_021929644.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X8, mRNA. (6784 bp)
X5" /protein_id="XP_017806752.3" /db_xref="GeneID:101006616" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIE...RFSGYFVPLIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGNLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1067
XM_017951263.3 - Papio anubis (olive baboon) - NCBI
PREDICTED: Gopherus evgoodei ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (6137 bp)
transporting ATPase 2 isoform X1" /protein_id="XP_030420154.1" /db_xref="GeneID:115652357" /translation="MKQNFAFDNIGYERSAENMPSLLPQTSTITVNILGMTCQSCVQSIEGRISKVKGIVSIKVSLEQSNAVIKYIQSEISPQEVCQEIGDMGFDASIAEARTTASSVRSTSLGEALMKLRVEGMTCQSCVNTIEGKIGKLHGVLRIKVSLSNQEAVIAYQPYIIQPEDLKKHIDNMGYESTIKSKQAPLKLGMIDLER...KFSGYFVPFIIIISAVTLLVWITIGFINFDVVQKYFPHQNKHLSKAEVILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRMLLLRDTAKLSLKKVLAIVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVRSVEAVLGQSEQSVNEQNAYLSSVSTISLGHSSSIMVSESDGAAAPLTYSVLIGNREWMRRNGLLISSDVNDAMTGHEMKGQTAILVAIDGALYGMIVIADTVKQEAALAVH...
AA_position 36 1039
XM_030564294.1 - Gopherus evgoodei (Goodes thornscrub tortoise) - NCBI
PREDICTED: Nomascus leucogenys ATPase copper transporting beta (ATP7B), mRNA. (7185 bp)
protein_id="XP_030669295.1" /db_xref="GeneID:100603669" /translation="MPEQERQITAREGASRKILSKLSLPTHAWEPAMKKSFAFDNVGYEGGLDGLGPFSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATMKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAVIKNKVAPLSLGPIDIERLQST...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIQFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKFLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPTEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1067
XM_030813435.1 - Nomascus leucogenys (northern white-cheeked gibbon) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (7465 bp)
translation="MDSAMEKARGDVPQSPEQSFLATLSDPHVTLLSVHKQWSFRKSPGVRHSARPVSTMEEGTSLSEEGEFPQRVLNGTWKMSSNQILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGP...RFSGYFVPLIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGNLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 133 1133
XM_031655864.1 - Papio anubis (olive baboon) - NCBI
PREDICTED: Calypte anna ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (6602 bp)
MIMERKLDNKMKSEVSCLATLNNKNITLVSIRKQQAAHDVPELLIIGEKSKAESPVKASSNSQKEEKLLQSYSMGMPEVNAVERQALSNTDSPPGCELEPTMKQSFAFDNMGYEESFETLLSPSSQEHTMAVRIVGMTCQSCVQSIEGRISKVEGIVSIKVSLEKNNAVIKYLQSEISPEQICQEIQDMGFDANIAEERLTTETLNASCVREAIVKLRVEGMTCQSCATSIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKSHIGNLGYNCTIKSKSAPLKLGVLDLERLQNA...KFSGYFVPFIIIISTVTLIAWITIGFMNFDIIKKYFPKQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAFLSTAEEPLDKMDTGRSGGSTAPLGENALITLSESQAPSSPTYSVLIGNREWMRRNGLQIANDINDAMTDHEMKGQTAILVAIDGVLRGMIAVADTVKQEAALAVHT...
AA_position 137 1126
XM_030464403.1 - Calypte anna (Anna's hummingbird) - NCBI
PREDICTED: Gorilla gorilla gorilla ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (7023 bp)
X4" /protein_id="XP_018895398.1" /db_xref="GeneID:101153085" /translation="MPEQERQMTAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNGMGFEAAIKNKVAPLSLGPIDIE...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1013
XM_019039853.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI
PREDICTED: Gorilla gorilla gorilla ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (7050 bp)
X3" /protein_id="XP_018895397.1" /db_xref="GeneID:101153085" /translation="MPEQERQMTAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNGMGFEAAIKNKVAPLSLGPIDIE...AGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1022
XM_019039852.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI
PREDICTED: Globicephala melas ATPase copper transporting beta (ATP7B), mRNA. (5936 bp)
translation="MERAGGQMPGSPEPSFLVTLGDPQVTLLSVHKRWSFRRSPRVTGSSRPVISEEECSPPSEKGEFSQKVLNKTQEVSSKQILPKISWPARTWEPTMKQSFAFDNNGYEDGLDGVHPSQTATGTISIVGMTCQSCVKSIEGRVSSLKGIVSVKVSLEQGSAMVRYMPSVLSLPQVCCQIEDMGFQATVAEGKAASRPSRFSPALEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVMRVRVSLSNQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNKVAPVSLGPIDIRQ...RFSGYFVPFIVIVSTLTLVVWIAIGFIDFGVVQKYFPTSSKHISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLELAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVARYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAQGERPRGQPTAHLNGVSSIPMETDAVPQTFSVLIGSREWMRRNGLTVTSDVSDAMTDHETKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 128 1114
XM_030882399.1 - Globicephala melas (long-finned pilot whale) - NCBI
PREDICTED: Camelus dromedarius ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (4557 bp)
copper-transporting ATPase 2 isoform X4" /protein_id="XP_031321815.1" /db_xref="GeneID:105090992" /translation="MKQSFAFDNTGYEDGLDGMCPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVVEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMNLGL...RFSGYFVPFIIIISTLTSVVWIVIGFIDFGVVQKYFPTPNKHISQVEVVFRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDMATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETMGYCTDFQAVPGCGIGCKVSSVEGILAQGERLQNERTAHLNGVSSIPVETDAAPQTFSVLIGNREWMRRNGLTVTSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 34 1029
XM_031465955.1 - Camelus dromedarius (Arabian camel) - NCBI
PREDICTED: Leptonychotes weddellii ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (5155 bp)
MTRWRGEGELLARMVGKGVTVDTAMEEAGGEMPRSPEPSFLATLGDPQVTLVSVHKRWSFRRNAGARGSTRPVTSEEEGEFSQKVLNGTRGIRSNQILSKVSLPARAGEPAMKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPI...KLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVAMMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHGERQQSKQAAPLSRTGSVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 145 1127
XM_031035771.1 - Leptonychotes weddellii (Weddell seal) - NCBI
PREDICTED: Camelus dromedarius ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (4496 bp)
ATPase 2 isoform X3" /protein_id="XP_031321814.1" /db_xref="GeneID:105090992" /translation="MQILSKLSWTARAWEPEMKQSFAFDNTGYEDGLDGMCPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVVEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMNLGLIDV...RFSGYFVPFIIIISTLTSVVWIVIGFIDFGVVQKYFPTPNKHISQVEVVFRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDMATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETMGYCTDFQAVPGCGIGCKVSSVEGILAQGERLQNERTAHLNGVSSIPVETDAAPQTFSVLIGNREWMRRNGLTVTSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 51 1046
XM_031465954.1 - Camelus dromedarius (Arabian camel) - NCBI
PREDICTED: Gorilla gorilla gorilla ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6605 bp)
copper-transporting ATPase 2 isoform X2" /protein_id="XP_018895395.1" /db_xref="GeneID:101153085" /translation="MKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNGMGFEAAIKNKVAPLSLG...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 35 1035
XM_019039850.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI
PREDICTED: Leptonychotes weddellii ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (7286 bp)
MTRWRGEGELLARMVGKGVTVDTAMEEAGGEMPRSPEPSFLATLGDPQVTLVSVHKRWSFRRNAGARGSTRPVTSEEEGEFSQKVLNGTRGIRSNQILSKVSLPARAGEPAMKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPI...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVAMMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHGERQQSKQAAPLSRTGSVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 145 1145
XM_031035770.1 - Leptonychotes weddellii (Weddell seal) - NCBI
PREDICTED: Melopsittacus undulatus ATPase copper transporting beta (LOC101881860), transcript variant X1, mRNA. (6604 bp)
MERKLDNKMKRELSCLATLNNKNITLVSIRKQQAAHDVPELLIIGEKSKTGSPIKESSNLQKEEKVLQSYSMGMPAVNAVERQALSTTDSPPGFELEPTMKHSFAFDNMGYEDSFETGPSSSSQEHTVAVNIVGMTCQSCVQSIEGRISKVKGIVSIKVSLEQNNAVIKYLKSDISAEQICKEIQDMGFDANIAEERLTTAAVNLSCLKEAVVKLRVEGMTCQSCATNIEGKMRKLHGVAKVKVSLGNQEAIIAYYPYIIQPDDLKNHISNLGYECTIKSKSAPLKLGVLDLERLQNANP...QFSGYFVPFIIIISTVTLIVWITIGFINFDVIQKYFPNQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCREELGTQSLGYCTDFQAVPGCGISCKVGGVEAVLDMAEEGLDKLDANRSGDSSAPLGDNMLVMLSESHGPSVSHTYSVLIGNREWMRRNGLHIANDINDAMTDHETKGQTAILVAIDGMLCGMIAIADTVKQEAALAVH...
AA_position 135 1122
XM_031047718.1 - Melopsittacus undulatus (budgerigar) - NCBI
PREDICTED: Meleagris gallopavo ATPase copper transporting beta (ATP7B), transcript variant X7, mRNA. (5953 bp)
transporting ATPase 2 isoform X7" /protein_id="XP_019467671.1" /db_xref="GeneID:100541545" /translation="MKQNFAFDNMGYEETFEAMPSSSSQERTVAVNVVGMTCQSCVQSIEGRISKVKGVVSIKVSLELNNALVKYLQSEISPEQICQEIEDMGFDANVAEERLTPVSVNLPCSREAVMKLRIEGMTCQSCVTSIEGKIKKLHGVAKIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTIKSKSAPLKLGVLDVRN...KFSGYFVPFIIIISTVTLIVWITIGFINFDIIQKYFPNQNKHLSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTNFQAVPGCGISCKVGGVEAVVGMAEEGVDKLDANKSGDSSAPVGDDTLITLSESNGSSSSHTYSVLIGNREWMRRNGLHIANDVNDAMTDHETKGQTAILVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 36 1025
XM_019612126.2 - Meleagris gallopavo (turkey) - NCBI
PREDICTED: Strigops habroptila ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (4550 bp)
transporting ATPase 2 isoform X2" /protein_id="XP_030333113.1" /db_xref="GeneID:115604292" /translation="MKHSFAFDNMGYEDSFETGPSSSSQERTVAVNIVGMTCQSCVQSIEGRISKVKGIVSIKVSLEQNNAVIKYLQSDISPEQICQEIQDMGFDANTAEERLTTATVNLSCLKEAVVKLRIEGMTCQSCATNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKSHISNLGYDCTIKSKSAPLKLGVLNLER...KFSGYFVPFIIIISTVTLIVWITIGFINFDVIQKYFPKQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAILDMAEEGLDKLDANRSGDSSAPLGDNTLVMLSESHGPPVSHTYSVLIGNREWMRRNGLHIANDINDAMTDHETKGQTAVLVAIDGMLCGMIAIADTVKQEAALAVH...
AA_position 36 1025
XM_030477253.1 - Strigops habroptila (Kakapo) - NCBI
PREDICTED: Gopherus evgoodei ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (6386 bp)
translation="MERESDSDLKRDQSTLATLNNKNVTLVTFHKRQSSNAVPALLIVSEPSKSGSPGKAGDCSQKEEKVSQSYSVGASEVNSMNALSKSSSPATCVQEPTMKQNFAFDNIGYERSAENMPSLLPQTSTITVNILGMTCQSCVQSIEGRISKVKGIVSIKVSLEQSNAVIKYIQSEISPQEVCQEIGDMGFDASIAEARTTASSVRSTSLGEALMKLRVEGMTCQSCVNTIEGKIGKLHGVLRIKVSLSNQEAVIAYQPYIIQPEDLKKHIDNMGYESTIKSKQAPLKLGM...KFSGYFVPFIIIISAVTLLVWITIGFINFDVVQKYFPHQNKHLSKAEVILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRMLLLRDTAKLSLKKVLAIVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVRSVEAVLGQSEQSVNEQNAYLSSVSTISLGHSSSIMVSESDGAAAPLTYSVLIGNREWMRRNGLLISSDVNDAMTGHEMKGQTAILVAIDGALYGMIVIADTVKQEAALAVH...
AA_position 133 1136
XM_030564309.1 - Gopherus evgoodei (Goodes thornscrub tortoise) - NCBI
PREDICTED: Meleagris gallopavo ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6269 bp)
MERKLDNKMRRELSCLATLNNKNITLVSIRKQQAAHDVPELLIIGEGSKAGSLLEASSNLQKEEKVLQRNSMGMPEVNTTGRQVLSNADSPPSCALEPEMKQNFAFDNMGYEETFEAMPSSSSQERTVAVNVVGMTCQSCVQSIEGRISKVKGVVSIKVSLELNNALVKYLQSEISPEQICQEIEDMGFDANVAEERLTPVSVNLPCSREAVMKLRIEGMTCQSCVTSIEGKIKKLHGVAKIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTIKSKSAPLKLGVLDVRNLQSADP...KFSGYFVPFIIIISTVTLIVWITIGFINFDIIQKYFPNQNKHLSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTNFQAVPGCGISCKVGGVEAVVGMAEEGVDKLDANKSGDSSAPVGDDTLITLSESNGSSSSHTYSVLIGNREWMRRNGLHIANDVNDAMTDHETKGQTAILVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 135 1124
XM_019612125.2 - Meleagris gallopavo (turkey) - NCBI
PREDICTED: Strigops habroptila ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (4885 bp)
MERKLDNKMKRELSCLATLNNKNITLVSIRKRQAAHDVPELLIIGEKSKTGSPVKASSNSQKEEKLLQSYSMGMPEVNAVERQALSNTDSPPGCELESTMKHSFAFDNMGYEDSFETGPSSSSQERTVAVNIVGMTCQSCVQSIEGRISKVKGIVSIKVSLEQNNAVIKYLQSDISPEQICQEIQDMGFDANTAEERLTTATVNLSCLKEAVVKLRIEGMTCQSCATNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKSHISNLGYDCTIKSKSAPLKLGVLNLERLQNANP...KFSGYFVPFIIIISTVTLIVWITIGFINFDVIQKYFPKQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAILDMAEEGLDKLDANRSGDSSAPLGDNTLVMLSESHGPPVSHTYSVLIGNREWMRRNGLHIANDINDAMTDHETKGQTAVLVAIDGMLCGMIAIADTVKQEAALAVH...
AA_position 135 1124
XM_030477252.1 - Strigops habroptila (Kakapo) - NCBI
PREDICTED: Echinops telfairi ATPase copper transporting beta (ATP7B), mRNA. (4467 bp)
GeneID:101658383" /translation="MEKDRSQGSEQSALATLSDPQVTLLAAHKRRSSRSPGARGSTLPEDSSPSRKGERSQRGLTGTREIRPNQISSQPSVPARAWEPAMKQDFAYDNAGYESSENSVATSTVHIVGMTCQSCVKTIESMVSSMDGIVSVKVSLEQGNAAVRYMPSAVSLQQVCYLIEDIGFEASVTGGKAAPRPSPVGEALVKLRVEGMTCQSCVNSIEGKLGKLQGVVRAKVSLGNQEAVIAYQPYLIQPEDLRDHVSDMGFEATIKHKAAPLSLGPIDI...RFSGYFVPFIIVISTLTLVVWIIIGFIDFGVVQKHFPGHSKHISQTEVILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLELAHKIKTVMFDKTGTITHGVPKVTRFLLLVDVAALPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTEALGYCTDFQTVPGCGIGCKVSNVGGTLAPKEHLNGVSNGPAEKDAAPETFSVLIGNREWMRRNGLSISSDVSAAMTDHEMKGQTAVLVAIDGVLCGMIAIADSVKQEAVLAVHTLKSMGVDVVLITGDNRKT...
AA_position 114 1101
XM_013006878.1 - Echinops telfairi (small Madagascar hedgehog) - NCBI
PREDICTED: Rhinopithecus roxellana ATPase copper transporting beta (ATP7B), mRNA. (6755 bp)
protein_id="XP_010351222.1" /db_xref="GeneID:104653862" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVFLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVGKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQST...RFSGYFVPLIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGNLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1067
XM_010352920.2 - Rhinopithecus roxellana (golden snub-nosed monkey) - NCBI
PREDICTED: Chanos chanos ATPase copper transporting beta (atp7b), transcript variant X3, mRNA. (4397 bp)
TCRSEQDSTGGHRPNKSKENGGLPEGWLPQRHAFDNMAFEPGSPNELHPHSGHFSRATLSLSGLTSPSCVQAIHTRISALKGVASLSVSQASSLAWVDYHPSAVTSREICEQIKAMGYGVKDVAVTGETGVAESAVDEALVRIRVEGMTCQSCVRSIEGKMGTLAGVLGICVSLSDKEATVSFDCGKVQPEELRVCIEEMGFDAALMETTPLKSPQVANAAQDAMGGSREVTLGVEGMHCGSCVNNITKSVSDMLGVHSVLVSLENKSVNLKYDSSLITLDTVRGIVEGLPPGNFRVTLP...KLSGYFVPFIVIVSLITLVVWIVIGFLDFDVVVKYFPGYDENIPRTEVIVRFAFQASITVLSIACPCSLGLATPTAVMVGTGIGAQNGILIKGGEPLEMAHKIRTVMFDKTGTITNGVPRVTRVLVLWDQARLPLRTILAVVGTAEASSEHPLGIAVAKHCKEELGTESLGYCRDFQAVPGCGISCKVSNVEDLLQSTETTHTQAQTRLTLHGVTTDESSLTAEADTEPGGHVYSVLIGNRQWMRANGLHVTADVNEAMTSHESKGQTAILVAIDGVLCAMLAIADTVKAESALAVHTLR...
AA_position 201 1090
XM_030781092.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Geospiza fortis ATPase copper transporting beta (ATP7B), mRNA. (6137 bp)
MERKLDNKMKKELSYLATLNDRNISLLSIRKQQAARDVPELLIIGEKSKMASPPKASSNLQKEEKLSQSYSMGMTEVSTDERQALSNIDSPPGCELKPTMKHNFAFDNMGYEASSETMPSPPSQEHIVVLNIVGMTCQSCVQSIEGRISKVKGILRIKVSLEQNNAVIKYRQSEISPEQICQEILDMGFDANIAEEKLTTATVNFPSLKEAVAKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLDNQEAIIVYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANP...KFSGYFVPFIIIISTVTLIAWITIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITYGVPKVMRVLLMGDTAVLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVGGVEAILGTAEEAPNKLDANRTGDSSAPLGDNGVIPLLESQGPSASEKYSVLIGNREWMRRNGLNIANDVNDAMTNHEMKGQTAILVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 135 1124
XM_005420785.2 - Geospiza fortis (medium ground-finch) - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (6895 bp)
translation="MERAGGEKSGSPEPSFLATLADPQVTLLSVHKRWSFRRSPGARGSIRPVTSEEEGCRPEEGGFSQKVLNGTQEIGSDQILSKLPWTARAWEPEMKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGLIDVRRL...RFSGYFVPFIIIISTLTSVVWIVIGFTDFGVVQKYFPTPNKHISQVEVVFRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDMATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETMGYCTDFQAVPGCGIGCKVSSVEGILAQGERLQSEQTAHLNGVSSVPVETDAAPQTFSVLIGNREWMRRNGLTVTSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 127 1122
XM_015244304.2 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Camelus dromedarius ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (4850 bp)
X2" /protein_id="XP_010980703.1" /db_xref="GeneID:105090992" /translation="MKPEQERRIIDREEANRRILSKLSWTARAWEPEMKQSFAFDNTGYEDGLDGMCPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVVEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMNLGLIDVR...RFSGYFVPFIIIISTLTSVVWIVIGFIDFGVVQKYFPTPNKHISQVEVVFRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDMATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETMGYCTDFQAVPGCGIGCKVSSVEGILAQGERLQNERTAHLNGVSSIPVETDAAPQTFSVLIGNREWMRRNGLTVTSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 67 1062
XM_010982401.2 - Camelus dromedarius (Arabian camel) - NCBI
PREDICTED: Taeniopygia guttata ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (5424 bp)
MERKLDNKMKRELSCLATLNDRNISLVSIRKQQAACDVPELLIIGEKSKTASPVKASSNLQKEEKVLRSYSTGMTEVNTDERQALSNIDSPPGCELKPTMKHKFAFDNMGYEESSENMSSPPSQEHTVVVNIVGMTCQSCVQSIEGRICKVKGILRIKVSLEQNNAVIKYLQLEISPEQICQEILDMGFDANIAEEKLTTATVNLPSLKEAVAKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLDNQEAIIAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANP...KFSGYFVPFIIIISTVTLIVWITIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITYGVPKVMRVLLMGDTAVLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTERLGYCTDFQAVPGCGISCKVGGVEAILGIAEEGPNELDANRSGVSSAPLGDNRVITLLESQGPSTSQKYSVLIGNREWMRRNGLNIANDVNDAMTNHEMKGQTAILVAIDGVLCGMIAIADTVKQEAALAVH...
AA_position 135 1124
XM_030273244.1 - Taeniopygia guttata (zebra finch) - NCBI
PREDICTED: Clupea harengus ATPase copper transporting beta (atp7b), mRNA. (5096 bp)
MKKFTSNVKSLNSLTRHASNSAVEQVCMVDCPQIIKPISLTPVFGEHVLGPDGVLHKDGQEAVKPKQENGGVSDAWPPPKLGFDNLGFVPGSPCEMCPQARGLCCGARDSAVGRDTQVLTPPVKSALVRIRVEGMTCQSCVQSIEGRIGELPGVMAIQVYLSDKEASVTFNPGQVGPEELRTHIEDMGFDAILTSSPIPTSSHGRKLEVNAAAGEVAMTLGVEGMHCGSCVHNIQEHVSGLLGVCSVSVSLETRHMDLKYDPSLVTLEMVKGLVEGIPPGNFHVTLPTLPVETPAGIWTT...KLSGYFVPFIILVSVVTLVVWLIIGFLDFDIVAEYFPGYDKNIPHTDVIVRFAFQTSLTVLSIACPCALGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIKAVMFDKTGTITNGVPKVTRVLVLWDQARMPLRKVLAVVGTAEASSEHPLGMAVTKHCKQELDTKTLGFCHDFQAVPGCGISCRVSNIDELLRNLDQTAISLETHLTIQGATTDESILLNGSEPACNPGTYSVLIGNREWMRRNGLHITTDVDEAMTSHETKGQTAILVAIDGVLCAMLAIADTVKPESALAVHTLR...
AA_position 135 1025
XM_012819771.2 - Clupea harengus (Atlantic herring) - NCBI
PREDICTED: Meleagris gallopavo ATPase copper transporting beta (ATP7B), transcript variant X8, mRNA. (6055 bp)
MERKLDNKMRRELSCLATLNNKNITLVSIRKQQAAHDVPELLIIGEGSKAGSLLEASSNLQKEEKVLQRNSMGMPEVNTTGRQVLSNADSPPSCALEPEMKQNFAFDNMGYEETFEAMPSSSSQERTVAVNVVGMTCQSCVQSIEGRISKVKGVVSIKVSLELNNALVKYLQSEISPEQICQEIEDMGFDANVAEERLTPVSVNLPCSREAVMKLRIEGMTCQSCVTSIEGKIKKLHGVAKIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTIKSKSAPLKLGVLDVRNLQSADP...ESLITGEAMPVTKKPGSTVIAGSINAHGSVLVNATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADKFSGYFVPFIIIISTVTLIVWITIGFINFDIIQKYFPIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTNFQAVPGCGISCKVGGVEAVVGMAEEGVDKLDANKSGDSSAPVGDDTLITLSESNGSSSSHTYSVLIGNREWMRRNGLHIANDVNDAMTDHETKGQTAILVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 135 1059
XM_010728776.3 - Meleagris gallopavo (turkey) - NCBI
PREDICTED: Leptonychotes weddellii ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (4441 bp)
copper-transporting ATPase 2 isoform X3" /protein_id="XP_006740540.1" /db_xref="GeneID:102730267" /translation="MKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGP...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVAMMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHGERQQSKQAAPLSRTGSVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 34 1034
XM_006740477.2 - Leptonychotes weddellii (Weddell seal) - NCBI
PREDICTED: Actinia tenebrosa copper-transporting ATPase 1-like (LOC116290626), transcript variant X2, mRNA. (5343 bp)
db_xref="GeneID:116290626" /translation="MTCNSCVKTIEKTISQMNGVNEINVSLEEKEAQIKFNGKATNGELLTQAIEDVGFEATLQRVVDILTKENAYQKEKETSEGISEIDLKVLGMTCQSCVKSIQKALSHTSGVKNSNISLQEEKATIKYDASITTPEKLQEVIEDIGFEAILPKENSGLRNVMINVEGMTCNSCVNTIEAKIGQKNGVQSISVSLEKKQVQISYTAEKMTPEQLVEAIENMGFEAHLLNDGVNDDDKDIRMAVIAIAGMTCMSCVKTVEGK...ADKLSGYFVPVVVLISVLTLIVWLVMGYVNIKLLHKKFDPKADNKDEFIIGFAFQISITVLAIACPCALGLATPTAVMVGTGIGAQNGILIKGGEPLETAHKVTAVVFDKTGTITHGTPEVIKTALFVNPDVCSLPLLLAVAGTAENNSEHPLGVAVTKYAKKELNTETLGQCTGFEAVPGYGLSCTVTDVDGLLNVRVKNEQNIDVIIDGKVTDTLRDVSLNEEDSPPNLDSASTSNYKVLIGNRDWMQMNGLVVTDEIEEAMQTHELKGQTAVLIAIDGKLVAMMAVADTVKSEAQAT...
AA_position 92 925
XM_031697703.1 - Actinia tenebrosa (Australian red waratah sea anemone) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/SEHPL+MTCQSC
lang : en | div : | spe : | query_string : SEHPL MTCQSC | format : html | download :

0.000 | 0.000 | search_start;
0.079 | 0.079 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:SEHPL)%7C(nt:SEHPL)%7C(aa:SEHPL))?to=0&format=json
0.088 | 0.009 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:MTCQSC)%7C(nt:MTCQSC)%7C(aa:MTCQSC))?to=0&format=json
0.209 | 0.121 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:SEHPL)%7C(nt:SEHPL)%7C(aa:SEHPL))%26((full_search:*:MTCQSC)%7C(nt:MTCQSC)%7C(aa:MTCQSC))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.217 | 0.008 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]