GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2019-02-19 01:23:50, GGRNA : RefSeq release 92 (Jan, 2019)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Pan troglodytes ATPase copper transporting beta (ATP7B), transcript variant X12, mRNA. (7150 bp)
db_xref="GeneID:452734" /db_xref="VGNC:VGNC:13069" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIESKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTNPKRP...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLRALASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1067
XM_016925313.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes ATPase copper transporting beta (ATP7B), transcript variant X13, mRNA. (6923 bp)
db_xref="GeneID:452734" /db_xref="VGNC:VGNC:13069" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIESKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTNPKRP...GEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLRALASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 957
XM_016925314.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (6549 bp)
isoform X2" /protein_id="XP_016780794.1" /db_xref="GeneID:452734" /db_xref="VGNC:VGNC:13069" /translation="MKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIESKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIE...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLRALASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 35 1035
XM_016925305.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes ATPase copper transporting beta (ATP7B), transcript variant X9, mRNA. (7109 bp)
db_xref="GeneID:452734" /db_xref="VGNC:VGNC:13069" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIESKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTNPKRP...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLRALASHLNEAGSLPAEKGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGKKVAMVG...
AA_position 67 1067
XM_016925309.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes ATPase copper transporting beta (ATP7B), transcript variant X7, mRNA. (7118 bp)
db_xref="GeneID:452734" /db_xref="VGNC:VGNC:13069" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIESKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTNPKRP...AGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLRALASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1022
XM_016925307.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes ATPase copper transporting beta (ATP7B), transcript variant X10, mRNA. (7091 bp)
db_xref="GeneID:452734" /db_xref="VGNC:VGNC:13069" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIESKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTNPKRP...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLRALASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1013
XM_016925310.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes ATPase copper transporting beta (ATP7B), transcript variant X6, mRNA. (6920 bp)
isoform X2" /protein_id="XP_016780795.1" /db_xref="GeneID:452734" /db_xref="VGNC:VGNC:13069" /translation="MKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIESKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIE...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLRALASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 35 1035
XM_016925306.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (7110 bp)
isoform X2" /protein_id="XP_016780793.1" /db_xref="GeneID:452734" /db_xref="VGNC:VGNC:13069" /translation="MKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIESKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIE...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLRALASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 35 1035
XM_016925304.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Zalophus californianus ATPase copper transporting beta (ATP7B), transcript variant X6, mRNA. (4700 bp)
translation="MVVKGMTVDTAMEEAGGETSGSPEPSFLATLGDPQVTLVSVHKRRSFMRNAGARGSTRPVTSEEEGEFSRKVLNGTRGIRSNQILSKLSLPTRAGEPAMKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGVVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLQVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPI...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTKTLGYCTDFQAVPGCGIGCKVSNVEGILAQSEHQQSKQAAPLSRTGGVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMKDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 132 1132
XM_027589523.1 - Zalophus californianus (California sea lion) - NCBI
PREDICTED: Zalophus californianus ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (4808 bp)
copper-transporting ATPase 2 isoform X4" /protein_id="XP_027445323.1" /db_xref="GeneID:113919799" /translation="MKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGVVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLQVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGP...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTKTLGYCTDFQAVPGCGIGCKVSNVEGILAQSEHQQSKQAAPLSRTGGVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMKDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 34 1034
XM_027589522.1 - Zalophus californianus (California sea lion) - NCBI
PREDICTED: Zalophus californianus ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (4775 bp)
copper-transporting ATPase 2 isoform X4" /protein_id="XP_027445322.1" /db_xref="GeneID:113919799" /translation="MKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGVVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLQVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGP...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTKTLGYCTDFQAVPGCGIGCKVSNVEGILAQSEHQQSKQAAPLSRTGGVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMKDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 34 1034
XM_027589521.1 - Zalophus californianus (California sea lion) - NCBI
PREDICTED: Ursus arctos horribilis ATPase copper transporting beta (ATP7B), mRNA. (6625 bp)
translation="MVGKGVTMDPAMEEPGGETPGSPEPSFLATLGDPQVTLVSVHKRWSFRRSPGARGSTRPVTSEEEGEFAQKVLNGARGIRSNQILSKLSLPTRAWEPEMKQSFAFDNVGYEGGLDGVCPPQTTSTISVSGMTCQSCVQSIEGRISSLKGVVSIKVSLEQGSATVTYVPSILSLLQICHHIEDMGFEASVAEGKAASWPSRSSSGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPID...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITYGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGTLAHSERQRSKQAAPPSRVGGVPEEIDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 131 1131
XM_026493204.1 - Ursus arctos horribilis - NCBI
PREDICTED: Zalophus californianus ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (4752 bp)
translation="MVVKGMTVDTAMEEAGGETSGSPEPSFLATLGDPQVTLVSVHKRRSFMRNAGARGSTRPVTSEEEGEFSRKVLNGTRGIRSNQILSKLSLPTRAGEPAMKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGVVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLQVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPI...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTKTLGYCTDFQAVPGCGIGCKVSNVEGILAQSEHQQSKQAAPLSRTGGVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMKDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 132 1091
XM_027589519.1 - Zalophus californianus (California sea lion) - NCBI
PREDICTED: Zalophus californianus ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (4822 bp)
translation="MVVKGMTVDTAMEEAGGETSGSPEPSFLATLGDPQVTLVSVHKRRSFMRNAGARGSTRPVTSEEEGEFSRKVLNGTRGIRSNQILSKLSLPTRAGEPAMKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGVVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLQVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPI...KLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVTPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTKTLGYCTDFQAVPGCGIGCKVSNVEGILAQSEHQQSKQAAPLSRTGGVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMKDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 132 1114
XM_027589518.1 - Zalophus californianus (California sea lion) - NCBI
PREDICTED: Zalophus californianus ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (6923 bp)
translation="MVVKGMTVDTAMEEAGGETSGSPEPSFLATLGDPQVTLVSVHKRRSFMRNAGARGSTRPVTSEEEGEFSRKVLNGTRGIRSNQILSKLSLPTRAGEPAMKQSFAFDNVGYEGGLDGVCPPQMTSSTISISGMTCQSCVKSIEGRISSLKGVVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLQVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPI...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGMAVTKYCKEELGTKTLGYCTDFQAVPGCGIGCKVSNVEGILAQSEHQQSKQAAPLSRTGGVPEAIDATPQTFSVLIGNREWMRRNGLTISSDISDAMKDHEMKGQTAILVAIDGVLCAMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 132 1132
XM_027589517.1 - Zalophus californianus (California sea lion) - NCBI
PREDICTED: Terrapene mexicana triunguis copper-transporting ATPase 2-like (LOC112114385), transcript variant X2, mRNA. (5439 bp)
transporting ATPase 2-like isoform X2" /protein_id="XP_026509434.1" /db_xref="GeneID:112114385" /translation="MNQNFAFDNTGYEGSAENMPSLLPQTSTVTVNILGMTCQSCVQSIEGRISKVKGIVSIKISLEQSNAVIKYIQSEIGLQEICQEIGEMGFDANIAEGRTTASSVRSTSLGEALLKLRVEGMTCQSCVNIIEGKIGKLHGVLRIKVSLSNQEAVIAYQPYIIQPEDLKNHIDNMGYESTIKSKLAPLKLGM...KFSGYFVPFIIIISTVTLLVWITIGFINFDVVQKYFPHQNKHLSKAEVILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVVRMLLLGDMAKLSLKKVLAIVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVRSVEAVLGQSEQSVNEQNAYLSSVSTISLGHSSSIMVSESDGAAAPLTYSVLIGNREWMRRNGLLISSDVNDAMTGHEMKGQTAILVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 36 1039
XM_026653649.1 - Terrapene mexicana triunguis (Three-toed box turtle) - NCBI
PREDICTED: Terrapene mexicana triunguis copper-transporting ATPase 2 (LOC112117659), mRNA. (5877 bp)
translation="MERESDGDLKRDQSTLATLNNKNVTLVTFHKRQSSNGVPALLIVSEPSKSGSPGKAGDCSQKEEKVSQSYNVGASEVNSMHALSKSSSPASCVWEPVMNQNFAFDNTGYEGSAENMPSLLPQTSTVTVNILGMTCQSCVQSIEGRISKVKGIVSIKISLEQSNAVIKYIQSEIGLQEICQEIGEMGFDANIAEGRTTASSVRSTSLGEALLKLRVEGMTCQSCVNIIEGKIGKLHGVLRIKVSLSNQEAVIAYQPYIIQPEDLKNHIDNMGYESTIKSKLAPLKLGM...KFSGYFVPFIIIISTVTLLVWITIGFINFDVVQKYFPHQNKHLSKAEVILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVVRMLLLGDMAKLSLKKVLAIVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVRSVEAVLGQSEQSVNEQNAYLSSVSTISLGHSSSIMVSESDGAAAPLTYSVLIGNREWMRRNGLLISSDVNDAMTGHEMKGQTAILVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 133 1136
XM_026653490.1 - Terrapene mexicana triunguis (Three-toed box turtle) - NCBI
PREDICTED: Terrapene mexicana triunguis copper-transporting ATPase 2-like (LOC112114385), transcript variant X1, mRNA. (5701 bp)
translation="MERESDGDLKRDQSTLATLNNKNVTLVTFHKRQSSNAVPALLIVSEPSKSGSPGKAGDCSQKEEKVSQSYNVGASEVNSMHALSKSSSPASCVWEPVMNQNFAFDNTGYEGSAENMPSLLPQTSTVTVNILGMTCQSCVQSIEGRISKVKGIVSIKISLEQSNAVIKYIQSEIGLQEICQEIGEMGFDANIAEGRTTASSVRSTSLGEALLKLRVEGMTCQSCVNIIEGKIGKLHGVLRIKVSLSNQEAVIAYQPYIIQPEDLKNHIDNMGYESTIKSKLAPLKLGM...KFSGYFVPFIIIISTVTLLVWITIGFINFDVVQKYFPHQNKHLSKAEVILRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVVRMLLLGDMAKLSLKKVLAIVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVRSVEAVLGQSEQSVNEQNAYLSSVSTISLGHSSSIMVSESDGAAAPLTYSVLIGNREWMRRNGLLISSDVNDAMTGHEMKGQTAILVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 133 1136
XM_026653648.1 - Terrapene mexicana triunguis (Three-toed box turtle) - NCBI
PREDICTED: Manacus vitellinus ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (4846 bp)
transporting ATPase 2 isoform X4" /protein_id="XP_017926884.1" /db_xref="GeneID:103762416" /translation="MKHNFAFDNMGYEESFETTPSSSSQERTVTINIVGMTCQSCVQAIEGRISKVKGIVSIKVSREQNNAVIKYLQLEISPDQICLEIQDMGFDANVAEEKLTTATINLSSLKEAVVKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKRHINNLGYDCTIKSKSAPLKLGVLDLQR...KFSGYFVPFIIIISTVTLIVWITIGFINVDVIKKYFPNQSKHISKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITYGVPKVMRVLLLGDTAVISLKKILAVIGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAILSTANQGLDNLDANRSGDSRAPLGDNAVITLLESRGPSPSHTYSVLIGNREWMRRNGLNIANDVNDAMTDHETKGQTAILVAIDGVLCGMIAIADTVKQEAALAVH...
AA_position 36 1025
XM_018071395.1 - Manacus vitellinus (golden-collared manakin) - NCBI
PREDICTED: Manacus vitellinus ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (4713 bp)
isoform X3" /protein_id="XP_017926883.1" /db_xref="GeneID:103762416" /translation="MGMPEVNTVERQALSNIDSPPGCELEPTMKHNFAFDNMGYEESFETTPSSSSQERTVTINIVGMTCQSCVQAIEGRISKVKGIVSIKVSREQNNAVIKYLQLEISPDQICLEIQDMGFDANVAEEKLTTATINLSSLKEAVVKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKRHINNLGYDCTIKSKSAPLKLG...KFSGYFVPFIIIISTVTLIVWITIGFINVDVIKKYFPNQSKHISKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITYGVPKVMRVLLLGDTAVISLKKILAVIGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAILSTANQGLDNLDANRSGDSRAPLGDNAVITLLESRGPSPSHTYSVLIGNREWMRRNGLNIANDVNDAMTDHETKGQTAILVAIDGVLCGMIAIADTVKQEAALAVH...
AA_position 64 1053
XM_018071394.1 - Manacus vitellinus (golden-collared manakin) - NCBI
PREDICTED: Manacus vitellinus ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (4816 bp)
MERKQDSKTKRELSYLATLNDRNITLMSIRKQQAAHDVPELLIIGEKSKTGSPVKASSNLQKEEKLLQSYSMGMPEVNTVERQALSNIDSPPGCELEPTMKHNFAFDNMGYEESFETTPSSSSQERTVTINIVGMTCQSCVQAIEGRISKVKGIVSIKVSREQNNAVIKYLQLEISPDQICLEIQDMGFDANVAEEKLTTATINLSSLKEAVVKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKRHINNLGYDCTIKSKSAPLKLGVLDLQRLQNANP...KFSGYFVPFIIIISTVTLIVWITIGFINVDVIKKYFPNQSKHISKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITYGVPKVMRVLLLGDTAVISLKKILAVIGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVGGVEAILSTANQGLDNLDANRSGDSRAPLGDNAVITLLESRGPSPSHTYSVLIGNREWMRRNGLNIANDVNDAMTDHETKGQTAILVAIDGVLCGMIAIADTVKQEAALAVH...
AA_position 135 1124
XM_018071392.1 - Manacus vitellinus (golden-collared manakin) - NCBI
PREDICTED: Bos indicus x Bos taurus ATPase copper transporting beta (ATP7B), mRNA. (6427 bp)
translation="MERAGDQTPGNPEPSSLATLGDPQVTLLSVHKQWSFKRSPGTGGSSRPVISEEECPPPSEEGEFSQKVLNGSEEISSKQILSKLSQPAMKQSFAFDNNGYEDDLDGVRPSHTATGTINIVGMTCQSCVKSIEGRVSSLKGIVSIKVSLEQGSAEVRYVPSVVSLVQICHQIEDMGFQASVAEGKATSWPSRVSPASEAMVKLRVEGMTCQSCVSSIEGKIGKLQGVLRVRVSLSNQEAVITYQPYLIQPQDLRDHITDMGFEAVIKNKVAPVSLGPIDVRRLQSTLS...RFSGYFVPFIIIISTVTLVVWIGIGFTDFGVVQKYFPVPSKGISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVSRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETLGCCTDFQAVPGCGISCKVSSVESILAQGERLQGPLTTHLNRVGSNPTETDAATQTFSVLIGNREWMRRNGLTVTSDVRDAMTDHEMKGQTAILVAIDGVLCGMIAIADSVKQEAALAVHTLKSMGVDVVL...
AA_position 122 1107
XM_027557321.1 - Bos indicus x Bos taurus (hybrid cattle) - NCBI
PREDICTED: Anas platyrhynchos ATPase copper transporting beta (ATP7B), mRNA. (6841 bp)
id="XP_012950559.2" /db_xref="GeneID:101795264" /translation="MATPLEAAKMLGTVFSRRSLVSFIHTALSDTDSPPSCALEPTMKQHFAFDNMGYEESFETLPSPSSQEHTVAVRIVGMTCQSCVQSXEGRISKVKGVVSIKVSLEQNNALVKYLQSEISPEQICQEIQDMGFDANVAEERLTPASVSLPCSREAVIKLRIEGMTCQSCVTSIEGKMKKLHGVAKIKVSLANQEAIIAYQPYIIQPEELKSHISSLGYNCTIKSKSAPLKLGVLDLGRL...RFSGYFVPFIIIISTVTLLVWITIGFIKFDIIQKYFPNQNKDVTKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTNFQAVPGCGISCKVGGVEAVLGMAEDGLGELDASRSRDSSVPLEDNALIALPESEGPSASHVYSVLIGNREWMRRNGLHIANDVNDAMTDHETKGQTAVLVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 78 1065
XM_013095105.2 - Anas platyrhynchos (mallard) - NCBI
PREDICTED: Xenopus laevis copper-transporting ATPase 2-like (LOC108709011), mRNA. (4280 bp)
transporting ATPase 2-like" /protein_id="XP_018104132.1" /db_xref="GeneID:108709011" /translation="MVSAWKQAKKPSLAFDNRGYEGSPGDLPSLPDDVGSVVVAIEGMTCQSCVQSIEGRISKVSGIVSINVCLEQNTAVVNYLQSEITQHKICAEIEDMGFDASLSEESGISSSLKSTYYSDDVTKIRVEGMTCQSCVNTIEGKIGKIQGVQKIKVSLNSQEAIVTYQSDIVQPEDLRKYIEDMGFEASIKNKLDPTKLGTIDV...KISGFFVPFIIIISVVTLVTWITIGFVNFDIIVKYFPSYNKNMSKTEVIIRVAFQTSITVLSIACPCALGLATPTAVMVGTGVAAQNGILIKGGEPLEMAHKINAVMFDKTGTITHGVPKVMRVLLLGDVVKMPLKRMLALVGTAEASSEHPLGMAVSKYCKEELGTESLGYCTDFQAVPGCGISCKVNNIESVLVQSEEGLNEQNSYRNSLISTTDSSLIITPELLGAQAPVAHTVLIGNREWMRRNGLHISTDVDEAMSSHEMKGQTAILVAIDGELCGMIAIADTVKQEAALAVHTL...
AA_position 44 1025
XM_018248643.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Corvus brachyrhynchos ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (5013 bp)
MERKLDNKMKRELSYLATLNDRNISLVSIRKQQAARDVPELLIIGEKSKTASLVKTSSNLQKEEELPQSYSMGMTEVNTVERQALSNTDSPPDCELKPTMKHNFAFDNMGYEESSETMPSPPSPEHSVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNHAVIKYLQSEISPEQICQEILDMGFDANIAEDKLTTATVNLPSLKEAVVKLRVEGMTCQSCVTSIEGKIRKLHGVAKIKVSLDNQEAIVAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANP...KFSGYFVPFIIIISTVTLIAWTTIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITCGVPKVMRVLLMGDTTMLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVGGVEAILGSELDVNISGDSSAPLGDNAVITLLESQGPSASQKYSVLIGNREWMRRNGLNIRNDVNDAMTNHEMKGQTAILVAIDGMLCGMIAIADTVKQEAALAVHTLQSMG...
AA_position 135 1131
XM_017731265.1 - Corvus brachyrhynchos (American crow) - NCBI
PREDICTED: Ailuropoda melanoleuca ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (4577 bp)
copper-transporting ATPase 2 isoform X2" /protein_id="XP_019653563.1" /db_xref="GeneID:100469748" /translation="MKQSFAFDNVGYEGGLDGACPPQTTSTVSVSGMTCQSCVQSIEGRISSLKGVVSIKVSLEQGSATVTYVPSILSLPQICHHIEDMGFEASVAEGKAASWPSRSSSGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPI...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITYGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHSEHPQSKQAAPPNTVGGIPEEIDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMFAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 33 1033
XM_019798004.1 - Ailuropoda melanoleuca (giant panda) - NCBI
PREDICTED: Panthera pardus ATPase copper transporting beta (ATP7B), mRNA. (5849 bp)
translation="MVGKGVTVDIAMEKAGGDTPGSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGTRGSTRPVTSEEEGEFSQKVLNGTRGIRSNQILSKHSLPARVWEPAMQQKQSFAFDNVGYEGGLDSMCPSQTTTGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVNYVPSVLSLPQVCRHIEDMGFEASITEGKAASWPSRSSSALEATVKLRVEGMTCQSCVSSIEGRLGKLQGVVRARVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLG...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLADVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGIVAHGKRQWSTQAGVSNSVGGVPEETDATPQTFSVLIGNREWMRRNGLTISSDISDTMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 134 1138
XM_019447639.1 - Panthera pardus (leopard) - NCBI
PREDICTED: Gorilla gorilla gorilla ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (7050 bp)
X3" /protein_id="XP_018895397.1" /db_xref="GeneID:101153085" /translation="MPEQERQMTAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNGMGFEAAIKNKVAPLSLGPIDIE...AGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1022
XM_019039852.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI
PREDICTED: Gorilla gorilla gorilla ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (7023 bp)
X4" /protein_id="XP_018895398.1" /db_xref="GeneID:101153085" /translation="MPEQERQMTAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNGMGFEAAIKNKVAPLSLGPIDIE...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 67 1013
XM_019039853.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI
PREDICTED: Hipposideros armiger ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6638 bp)
X3" /protein_id="XP_019524436.1" /db_xref="GeneID:109396763" /translation="MIPPQERPLQMRQGGYRKILSKLPLPARGREPEMKQSFAFDNAGYEGSLDGVCPPQTSTGTISILGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSVMSLPQVCCQIEDMGFEASIAEGKAGSWPSRSSPSLEAMVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLSNQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNKVAPVSLGPIDIG...QFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPNPSKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKINTVMFDKTGTITHGVPKVMRVLLLVDTATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTEALGYCTDFQAVPGCGIGCKVSSVEGILAHREHLSEQAAPLNGVGSVPVETDVAPQTFSVLIGNREWMRRNGLAISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAAYTLKSMGVDVVLI...
AA_position 67 1063
XM_019668891.1 - Hipposideros armiger (great roundleaf bat) - NCBI
PREDICTED: Serinus canaria ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6184 bp)
transporting ATPase 2 isoform X2" /protein_id="XP_018764170.1" /db_xref="GeneID:103827386" /translation="MKHNFAFDNMGYEASSETMPSPPSQEHTVVVNIVGMTCQSCVQSIEGRISKVNGILRIKVSLEQNNAVIKYQQSEISPEQICQEILDMGFDANIAEEKVTTATVNLPSLKEAVAKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLDNQEAIIVYRPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGTLDLQR...KFSGYFVPFIIIISTVTLIAWITIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITYGVPKVTRVLLMGDTAVLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTNFQAVPGCGISCKVGGVEVILGTAEEGPNKLDANRRGDSSAPLGDTGVITLLESQGPSASQKYSVLIGNREWMRRNGLNIANDVNDAMTNHEMKGQTAILVAIDGVLCGMIAIADTVKQEAALAVH...
AA_position 36 1025
XM_018908625.1 - Serinus canaria (common canary) - NCBI
PREDICTED: Hipposideros armiger ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6588 bp)
copper-transporting ATPase 2 isoform X2" /protein_id="XP_019524435.1" /db_xref="GeneID:109396763" /translation="MKQSFAFDNAGYEGSLDGVCPPQTSTGTISILGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSVMSLPQVCCQIEDMGFEASIAEGKAGSWPSRSSPSLEAMVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLSNQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNKVAPVSLGP...QFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPNPSKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKINTVMFDKTGTITHGVPKVMRVLLLVDTATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTEALGYCTDFQAVPGCGIGCKVSSVEGILAHREHLSEQAAPLNGVGSVPVETDVAPQTFSVLIGNREWMRRNGLAISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAAYTLKSMGVDVVLI...
AA_position 34 1030
XM_019668890.1 - Hipposideros armiger (great roundleaf bat) - NCBI
PREDICTED: Aptenodytes forsteri ATPase copper transporting beta (ATP7B), mRNA. (4287 bp)
product="copper-transporting ATPase 2" /protein_id="XP_019330386.1" /db_xref="GeneID:103907912" /translation="MKHNFAFDNMGYEESFETAPSPSSQEHTVAVSVVGMTCQSCVQSIEGRISKVKGIVSIKVSLEQNNAVIKYLQSEISPEQICQEIQDMGFDANIAEERLTTATVNLSCLREAVVKLQVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKSHISNLGYACTIKSKSAPLKLGV...KFSGYFVPFIIIISTVTLIVWITIGFINFDVIQKYFPNQNKHVSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGAPKVMRVLLLGDPAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTDFQAVPGCGISCKVRGVEAILGMAEEGLDKLDTNRSRNSSAPMGDNALITFSKSHASHTYLVLIGNREWMRRNGLHIANDINDAMTDHEMKGQTAILVAINGMLCGMIAIADTVKQEAALAVHTLK...
AA_position 36 1025
XM_019474841.1 - Aptenodytes forsteri (emperor penguin) - NCBI
PREDICTED: Gorilla gorilla gorilla ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6605 bp)
copper-transporting ATPase 2 isoform X2" /protein_id="XP_018895395.1" /db_xref="GeneID:101153085" /translation="MKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNGMGFEAAIKNKVAPLSLG...RFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 35 1035
XM_019039850.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI
PREDICTED: Capra hircus ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (5039 bp)
isoform X3" /protein_id="XP_017912189.1" /db_xref="GeneID:102183524" /translation="MKPEDERPIIDREKASRRILSKLFQPAMKQSFAFDNNGYEDDLDGVCPSQTAAGTISIVGMTCQSCVKSIEGRVSSLKGIVSIKVSLEQGSAEVRYVPSVVSLMQICHQIEDMGFQASVAEGKATSWASRVSPTSEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLSNQEAVITYQPYLIQPQDLRDHITDMGFEAVIKNKVAPVSLGPID...RFSGYFVPFIIIISTVTLVVWIVIGFIDFGVVQKYFPAPSKGISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVSRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVTRHCKEELGTETLGCCMDFQAVPGCGISCKVSNVESILAQGERPQGPPTAHQNRVGSEPSETDAATQTFSVLIGNREWMRRNGLTVTSDVRDAMTDHETKGQTAILVAIDGVLCGMIAVADSVKQEAALAVHTLKSMGVDVVL...
AA_position 61 1046
XM_018056700.1 - Capra hircus (goat) - NCBI
PREDICTED: Xenopus laevis copper-transporting ATPase 2-like (LOC108708674), mRNA. (5133 bp)
XP_018103099.1" /db_xref="GeneID:108708674" /translation="MFPKGILDEEEEVQLLSPEREKRLTKRRPSPQFCVNKTFYDFPVSAWKQAKKPSLAFDNRGYEGSPDDLPSLPDDVGSVVVAIEGMTCQSCVQSIEGRISKILGIVSINVCLEQNNAVVNYLQLEITPHQICEEIEDMGFDASLSEEMGITSSLKSTYYGDDVIKIRVEGMTCQSCVNTIEGKIGKIQGVQKIKVSLSSQEAIITYKSDIIQPEDLRKYIEDMGFEASIKNKPDPTKLGTID...KISGYFVPFIIIISVVTLVTWITIGFVNFDIIIKYFPSYNQNISKTEVIIRVAFQTSITVLSIACPCALGLATPTAVMVGTGVAAQNGILIKGGEPLEMAHKIKAVMFDKTGTITHGVPKVMRVLLLGDVLKMPLKRMLAVVGTAEASSEHPLGMAVSKYCKEELGTETLGYCTDFQAVPGCGISCKVNNIESVLVQSEEGLNEQNSYRNSLLSTTDSSLIISPELLGAQAPAPHTVLIGNREWMRRNGLHISTDVDEAMSSHEMKGQTAILVAIDGELCGMIAIADTVKEEAALAVHTL...
AA_position 86 1061
XM_018247610.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Crocodylus porosus ATPase copper transporting beta (ATP7B), mRNA. (5026 bp)
translation="MERISDGNLKWEKSALATLNSNSITLVAVRKRQPATDVPELLIVSEKSKPGSPVKVHSSFQKEERVSQGCSMGVSEVKAEQALPKTSTPASCVWKPTMKQNFAFDNIGYEGNAENLPSGSSQMDMVTVNILGMTCQSCVHSVEGRISKVKGIVSIKVSLEHSNAVLKYIGSEISPIQICQEIEDMGFDACIAEGKSIPSSLRSTTSIAEAVVKFRVEGMTCQSCVNTIEGTVGKLHGVTRIKVSLSNQEAVILYQPFIVQPEDLKKRINNLGYESTIKTKLAPLKLG...KFSGYFVPFIIIISTVTLIVWIAIGFINFDVVQKFFPHRSKNISKAEIIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLGDTDTLSLKVVLAVVGTAEANSEHPLGMAITKYCKEELGTESLGYCMDFQAVPGCGISCKVSGAEAVLGQKEHSLNERNADLNGDSTVSLKHSSLIMISEPDGAAAPHTYLVVIGNREWMRRNGLHISNDVNDAMTGHETKGQTAVLVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 133 1130
XM_019529987.1 - Crocodylus porosus (Australian saltwater crocodile) - NCBI
PREDICTED: Nanorana parkeri ATPase copper transporting beta (ATP7B), mRNA. (4417 bp)
id="XP_018411947.1" /db_xref="GeneID:108787014" /translation="MSRRNFLEDEEEEVRLLSNYEVRYREKSMTKPSPHQSKNKNTAVWKKAERNNSAFDNQGYEGSQDDLAFSSSVVLAIVGMTCQSCVQSIEGKISKLPSIIRIKVCLDQNNATVHYIRSEITAQKICEEIEDMGFEASIQECKEMTAPQKGMSYKEEVIKIRIEGMTCQSCVNTIEGKIGKLQGVQKIKVSLTGQEAVIVYDPLYIQPEDLKKHIDDMGFVASLKSKPDPLKLGTIDIE...KISGYFVPFIIITSIVTLIAWITVGFVNFDIIIKYFPGYSKTMSKAEVIIRVAFQTSITVLSIACPCALGLATPTAVMVGTGVAAQNGILIKGGEPLEMAHKINIVMFDKTGTITHGVPKVMRVLLLCDVSRMPLKRMLAVVGTAEASSEHPLGVAVAKYCKEELGTASLGYCSDFQAVPGCGISCKVNNVESVLVQSEEGQNEYNVYKSGSQDNNSLIITPELQGASAPIPHAVLIGNREWMKRNGLHISHDVDDAMTSHEMKGQTAVLVAIDGALCGMIAIADTVKQEAALAVHTLMA...
AA_position 80 1064
XM_018556445.1 - Nanorana parkeri - NCBI
PREDICTED: Gavialis gangeticus ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (5170 bp)
translation="MERISDHNLKWEKSSLATLNSNSITLVAVRKQQPATDVPELLIVSEKSKPGSPVKVHSSFQKEERVSQGCSMGVSEVKAEQALPKTSTPASCVRKPTMKQNFAFDNIGYEGNSENLSSGSSQMDIVTVNILGMTCQSCVHSVEGRISKVKGIVSIKVSLERSNAVLKYIRSEISPIQICQEIEDMGFDACIAEGKSIPSSLRSTTSIAEAVVKFRVEGMTCQSCVNTIEGTVGKLHGVTRIKVSLSNQEAVILYQPFIVQPEDLKKHINNLGYESTIKTKLAPLTLG...KFSGYFVPFIIIISTVTLIVWIAMGFINFEVVQKFFPHRSKNISKAEIIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLGDTDTLSLKVVLAVVGTAEANSEHPLGMAITKYCKEELGTESLGYCMDFQAVPGCGISCKVSGVEAVLGQKEHSLNERNADLHGDGTVSLKHSSLIMISEPDGAAAPHTYLVVIGNREWMRRNGLHISNDVNDAMTGHEMKGQTAVLVAMDGALCGMIAIADTVKQEAALAVH...
AA_position 133 1130
XM_019525164.1 - Gavialis gangeticus (Gharial) - NCBI
PREDICTED: Gavialis gangeticus ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (6647 bp)
translation="MERISDHNLKWEKSSLATLNSNSITLVAVRKQQPATDVPELLIVSEKSKPGSPVKVHSSFQKEERVSQGCSMGVSEVKAEQALPKTSTPASCVRKPTMKQNFAFDNIGYEGNSENLSSGSSQMDIVTVNILGMTCQSCVHSVEGRISKVKGIVSIKVSLERSNAVLKYIRSEISPIQICQEIEDMGFDACIAEGKSIPSSLRSTTSIAEAVVKFRVEGMTCQSCVNTIEGTVGKLHGVTRIKVSLSNQEAVILYQPFIVQPEDLKKHINNLGYESTIKTKLAPLTLG...KFSGYFVPFIIIISTVTLIVWIAMGFINFEVVQKFFPHRSKNISKAEIIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVMRVLLLGDTDTLSLKVVLAVVGTAEANSEHPLGMAITKYCKEELGTESLGYCMDFQAVPGCGISCKVSGVEAVLGQKEHSLNERNADLHGDGTVSLKHSSLIMISEPDGAAAPHTYLVVIGNREWMRRNGLHISNDVNDAMTGHEMKGQTAVLVAMDGALCGMIAIADTVKQEAALAVH...
AA_position 133 1130
XM_019525163.1 - Gavialis gangeticus (Gharial) - NCBI
PREDICTED: Capra hircus ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (5184 bp)
translation="MERAGDQTPGNPEPSSLATLGDPQVTLLTVHKQWSFKRSPGTGGSSRPVISEEECPPPSEEGEFSQKVLNGSEEISSKQILSKLFQPAMKQSFAFDNNGYEDDLDGVCPSQTAAGTISIVGMTCQSCVKSIEGRVSSLKGIVSIKVSLEQGSAEVRYVPSVVSLMQICHQIEDMGFQASVAEGKATSWASRVSPTSEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLSNQEAVITYQPYLIQPQDLRDHITDMGFEAVIKNKVAPVSLGPIDVRRLQSTLS...KLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTVTLVAPSKGISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVSRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVTRHCKEELGTETLGCCMDFQAVPGCGISCKVSNVESILAQGERPQGPPTAHQNRVGSEPSETDAATQTFSVLIGNREWMRRNGLTVTSDVRDAMTDHETKGQTAILVAIDGVLCGMIAVADSVKQEAALAVHTLKSMGVDVVL...
AA_position 122 1089
XM_018056699.1 - Capra hircus (goat) - NCBI
PREDICTED: Hipposideros armiger ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (7000 bp)
translation="MEKAGSETPGNPEQSYLATLCDSQVTLLSVHKQWSFRRSPGVRGPSRPAPSEEEGSPPSLEGECSQKVLNGTREISSSQILSKLPLPARGREPEMKQSFAFDNAGYEGSLDGVCPPQTSTGTISILGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSVMSLPQVCCQIEDMGFEASIAEGKAGSWPSRSSPSLEAMVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLSNQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNKVAPVSLGPIDIGR...QFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPNPSKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKINTVMFDKTGTITHGVPKVMRVLLLVDTATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTEALGYCTDFQAVPGCGIGCKVSSVEGILAHREHLSEQAAPLNGVGSVPVETDVAPQTFSVLIGNREWMRRNGLAISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAAYTLKSMGVDVVLI...
AA_position 128 1124
XM_019668889.1 - Hipposideros armiger (great roundleaf bat) - NCBI
PREDICTED: Rhinopithecus bieti ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (6443 bp)
copper-transporting ATPase 2 isoform X3" /protein_id="XP_017713764.1" /db_xref="GeneID:108519344" /translation="MKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVGKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLG...RFSGYFVPLIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGNLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 35 1035
XM_017858275.1 - Rhinopithecus bieti (black snub-nosed monkey) - NCBI
PREDICTED: Rhinopithecus bieti ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6476 bp)
copper-transporting ATPase 2 isoform X3" /protein_id="XP_017713763.1" /db_xref="GeneID:108519344" /translation="MKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVGKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLG...RFSGYFVPLIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGNLPAEKDAAPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVL...
AA_position 35 1035
XM_017858274.1 - Rhinopithecus bieti (black snub-nosed monkey) - NCBI
PREDICTED: Capra hircus ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (6330 bp)
translation="MERAGDQTPGNPEPSSLATLGDPQVTLLTVHKQWSFKRSPGTGGSSRPVISEEECPPPSEEGEFSQKVLNGSEEISSKQILSKLFQPAMKQSFAFDNNGYEDDLDGVCPSQTAAGTISIVGMTCQSCVKSIEGRVSSLKGIVSIKVSLEQGSAEVRYVPSVVSLMQICHQIEDMGFQASVAEGKATSWASRVSPTSEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLSNQEAVITYQPYLIQPQDLRDHITDMGFEAVIKNKVAPVSLGPIDVRRLQSTLS...RFSGYFVPFIIIISTVTLVVWIVIGFIDFGVVQKYFPAPSKGISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVSRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVTRHCKEELGTETLGCCMDFQAVPGCGISCKVSNVESILAQGERPQGPPTAHQNRVGSEPSETDAATQTFSVLIGNREWMRRNGLTVTSDVRDAMTDHETKGQTAILVAIDGVLCGMIAVADSVKQEAALAVHTLKSMGVDVVL...
AA_position 122 1107
XM_018056698.1 - Capra hircus (goat) - NCBI
PREDICTED: Corvus brachyrhynchos ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (6358 bp)
transporting ATPase 2 isoform X4" /protein_id="XP_017586753.1" /db_xref="GeneID:103613590" /translation="MKHNFAFDNMGYEESSETMPSPPSPEHSVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNHAVIKYLQSEISPEQICQEILDMGFDANIAEDKLTTATVNLPSLKEAVVKLRVEGMTCQSCVTSIEGKIRKLHGVAKIKVSLDNQEAIVAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQR...KFSGYFVPFIIIISTVTLIAWTTIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITCGVPKVMRVLLMGDTTMLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVGGVEAILGSELDVNISGDSSAPLGDNAVITLLESQGPSASQKYSVLIGNREWMRRNGLNIRNDVNDAMTNHEMKGQTAILVAIDGMLCGMIAIADTVKQEAALAVHTLQSMG...
AA_position 36 1032
XM_017731264.1 - Corvus brachyrhynchos (American crow) - NCBI
PREDICTED: Ficedula albicollis ATPase copper transporting beta (ATP7B), mRNA. (6199 bp)
MERKLDNKMKRELSYLATLNDRNISLVAIRKQQAACDVPELLIIGEKSKTASPVKARRSLQKEEKLLQSYSMGKTEVNTVERQALSNIDSPPDCELKPTMKHNFAFDNMGYEESSETVPSPPSQEHTVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNNAVIKYLQSEINPEQICQEILGMGFDASVAEEKSTAATVNLPSLKEAVVKLRVEGMTCQSCVTNIEGKIRKMHGVAKIKVSLDNQEAIIAYHPYIIQPDDLKRHISDMGYDCTIKSKSAPLKLGALDLQRLQNAKS...KFSGYFVPFIIIISTVTLIVWITIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITYGVPKVMRVLLMGDTAVLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAIPGCGISCKVGGVEAVLGTAEEGPNKQDANRSAALGDKAAITPLESQGPSASQKYSVLIGNREWMRRNGLNITNDVNDAMTNHEMKGQTAILVAIDGVLCGMIAIADTVKQEAALAVHTLQS...
AA_position 135 1122
XM_016300582.1 - Ficedula albicollis (collared flycatcher) - NCBI
PREDICTED: Ailuropoda melanoleuca ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (4970 bp)
translation="MVGKGVTVDPAMEEAGSETPGSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGARGSTRPVTSEEEEEFAQKVLNGARGIRSNQILSKLSLPTRAWEPEMKQSFAFDNVGYEGGLDGACPPQTTSTVSVSGMTCQSCVQSIEGRISSLKGVVSIKVSLEQGSATVTYVPSILSLPQICHHIEDMGFEASVAEGKAASWPSRSSSGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPID...RFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITYGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHSEHPQSKQAAPPNTVGGIPEEIDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMFAIADAVKQEAALAVHTLKSMGVDVVL...
AA_position 131 1131
XM_002917677.3 - Ailuropoda melanoleuca (giant panda) - NCBI
PREDICTED: Meleagris gallopavo ATPase copper transporting beta (ATP7B), transcript variant X7, mRNA. (4619 bp)
transporting ATPase 2 isoform X7" /protein_id="XP_019467671.1" /db_xref="GeneID:100541545" /translation="MKQNFAFDNMGYEETFEAMPSSSSQERTVAVNVVGMTCQSCVQSIEGRISKVKGVVSIKVSLELNNALVKYLQSEISPEQICQEIEDMGFDANVAEERLTPVSVNLPCSREAVMKLRIEGMTCQSCVTSIEGKIKKLHGVAKIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTIKSKSAPLKLGVLDVRN...KFSGYFVPFIIIISTVTLIVWITIGFINFDIIQKYFPNQNKHLSKAELILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITCGVPKVMRVLLLGDTAVLSLKKVLAVVGTAEASSEHPLGVAVTKYCKEELGTQSLGYCTNFQAVPGCGISCKVGGVEAVVGMAEEGVDKLDANKSGDSSAPVGDDTLITLSESNGSSSSHTYSVLIGNREWMRRNGLHIANDVNDAMTDHETKGQTAILVAIDGALCGMIAIADTVKQEAALAVH...
AA_position 36 1025
XM_019612126.1 - Meleagris gallopavo (turkey) - NCBI
PREDICTED: Corvus brachyrhynchos ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6332 bp)
X3" /protein_id="XP_017586752.1" /db_xref="GeneID:103613590" /translation="MPGTVFSGWNLRSFIYTALSNTDSPPDCELKPTMKHNFAFDNMGYEESSETMPSPPSPEHSVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNHAVIKYLQSEISPEQICQEILDMGFDANIAEDKLTTATVNLPSLKEAVVKLRVEGMTCQSCVTSIEGKIRKLHGVAKIKVSLDNQEAIVAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALD...KFSGYFVPFIIIISTVTLIAWTTIGFVNFDIIKKYFPNQSKNISKAEIILRFAFQTSITVLSIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHQIKTVMFDKTGTITCGVPKVMRVLLMGDTTMLPLKKVLAVVGTAEASSEHPLGMAVTKYCKEELGTESLGYCTDFQAVPGCGISCKVGGVEAILGSELDVNISGDSSAPLGDNAVITLLESQGPSASQKYSVLIGNREWMRRNGLNIRNDVNDAMTNHEMKGQTAILVAIDGMLCGMIAIADTVKQEAALAVHTLQSMG...
AA_position 69 1065
XM_017731263.1 - Corvus brachyrhynchos (American crow) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/SEHPL+MTCQSC
lang : en | div : | spe : | query_string : SEHPL MTCQSC | format : html | download :

0.000 | 0.000 | search_start;
0.077 | 0.077 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:SEHPL)%7C(nt:SEHPL)%7C(aa:SEHPL))?to=0&format=json
0.086 | 0.008 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:MTCQSC)%7C(nt:MTCQSC)%7C(aa:MTCQSC))?to=0&format=json
0.136 | 0.050 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:SEHPL)%7C(nt:SEHPL)%7C(aa:SEHPL))%26((full_search:*:MTCQSC)%7C(nt:MTCQSC)%7C(aa:MTCQSC))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.143 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]