GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2020-04-06 11:52:00, GGRNA : RefSeq release 99 (Mar, 2020)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Xenopus tropicalis ATPase, Cu++ transporting, beta polypeptide (atp7b), mRNA. (7902 bp)
XB-GENE-6044681" CDS 394..4797 /gene="atp7b" /codon_start=1 /product="copper-transporting ATPase 2" /protein_id="XP_002936778.3" /db_xref="GeneID:100497797" /db_xref="Xenbase:XB-GENE-6044681" /translation="MFPKRILDEEEGVQLLSTENEKCSTKRRSSPQFCVNNTFSDSPVSVWKEAKKPSCAFDNRGYEGSPDDLCSLPDDVGSVVVAIQGMTCQSCVQSIEGRISKVSGVVGINVCLEQNNAIVNYLQTEITPHKICEEIEDMGFDASLSEQSGMPSSVKSSYYGDNVIKIRVEGMTCQSCVNTIEGKIGKIQGVQKIKVSLTGQEAVITYQSHIIQAEDLRKYIEDMGFEASIKNKPDPTKLGTIDIERLQNSIAENHSGHTNSNTVTLGIDGMRCKSCVHNIEGYVSGLAGIQSIRVSLKNKNAVVCLSQGSTSLLSLKESIENLPPGKFKVTLPVGVEKGQSLARNSTHSSHRDQSMGGNMAIISIGGMTCQSCVSSIENMISQRKGVLHILVSLD...
AA_position 86
XM_002936732.5 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Galleria mellonella copper-transporting ATPase 2-like (LOC113514436), transcript variant X4, mRNA. (1815 bp)
samples with support for all annotated introns" /db_xref="GeneID:113514436" CDS 333..1811 /gene="LOC113514436" /codon_start=1 /product="copper-transporting ATPase 2-like isoform X2" /protein_id="XP_031764017.1" /db_xref="GeneID:113514436" /translation="MAHMYEGTEMLEKNKRESSQELVAVRVPIIGMTCQSCVKSIEGSVSEMPGVHHVKVELSEKAGYFRYDPRVCSVEAIRSHIEDMGFEVPSENGDETSQLLPKEIPTDLLIDMSGVSGDGETEVFLSVVGMTCQSCVNTIEGALKELPGVIEPSVDLAAGTARVRCSPGALTPRQVADTVYDLGFDVTIVSVDGKQYNENNTPETKSDQGSGDGIKPPSPVKSKTQANGSARARSAPEVWRCTLEVRGMTCASCVAAIEKHCSKIYGVHSINIGLLAAKAEVKYEPRAISAADIAHSITELGFPADVVSDCDGSGQKDLVVVIKGMTCASCVNKIEKAVLKLDGVTAC...
AA_position 32
XM_031908157.1 - Galleria mellonella (greater wax moth) - NCBI
PREDICTED: Galleria mellonella copper-transporting ATPase 2-like (LOC113514436), transcript variant X3, mRNA. (1654 bp)
samples with support for all annotated introns" /db_xref="GeneID:113514436" CDS 169..1650 /gene="LOC113514436" /codon_start=1 /product="copper-transporting ATPase 2-like isoform X1" /protein_id="XP_031764016.1" /db_xref="GeneID:113514436" /translation="MLSRGVKYQRLDDLEIGESSQELVAVRVPIIGMTCQSCVKSIEGSVSEMPGVHHVKVELSEKAGYFRYDPRVCSVEAIRSHIEDMGFEVPSENGDETSQLLPKEIPTDLLIDMSGVSGDGETEVFLSVVGMTCQSCVNTIEGALKELPGVIEPSVDLAAGTARVRCSPGALTPRQVADTVYDLGFDVTIVSVDGKQYNENNTPETKSDQGSGDGIKPPSPVKSKTQANGSARARSAPEVWRCTLEVRGMTCASCVAAIEKHCSKIYGVHSINIGLLAAKAEVKYEPRAISAADIAHSITELGFPADVVSDCDGSGQKDLVVVIKGMTCASCVNKIEKAVLKLDGVTA...
AA_position 33
XM_031908156.1 - Galleria mellonella (greater wax moth) - NCBI
PREDICTED: Galleria mellonella copper-transporting ATPase 2-like (LOC113514436), transcript variant X2, mRNA. (1880 bp)
samples with support for all annotated introns" /db_xref="GeneID:113514436" CDS 395..1876 /gene="LOC113514436" /codon_start=1 /product="copper-transporting ATPase 2-like isoform X1" /protein_id="XP_031764015.1" /db_xref="GeneID:113514436" /translation="MLSRGVKYQRLDDLEIGESSQELVAVRVPIIGMTCQSCVKSIEGSVSEMPGVHHVKVELSEKAGYFRYDPRVCSVEAIRSHIEDMGFEVPSENGDETSQLLPKEIPTDLLIDMSGVSGDGETEVFLSVVGMTCQSCVNTIEGALKELPGVIEPSVDLAAGTARVRCSPGALTPRQVADTVYDLGFDVTIVSVDGKQYNENNTPETKSDQGSGDGIKPPSPVKSKTQANGSARARSAPEVWRCTLEVRGMTCASCVAAIEKHCSKIYGVHSINIGLLAAKAEVKYEPRAISAADIAHSITELGFPADVVSDCDGSGQKDLVVVIKGMTCASCVNKIEKAVLKLDGVTA...
AA_position 33
XM_031908155.1 - Galleria mellonella (greater wax moth) - NCBI
PREDICTED: Galleria mellonella copper-transporting ATPase 2-like (LOC113514436), transcript variant X1, mRNA. (1694 bp)
samples with support for all annotated introns" /db_xref="GeneID:113514436" CDS 209..1690 /gene="LOC113514436" /codon_start=1 /product="copper-transporting ATPase 2-like isoform X1" /protein_id="XP_031764014.1" /db_xref="GeneID:113514436" /translation="MLSRGVKYQRLDDLEIGESSQELVAVRVPIIGMTCQSCVKSIEGSVSEMPGVHHVKVELSEKAGYFRYDPRVCSVEAIRSHIEDMGFEVPSENGDETSQLLPKEIPTDLLIDMSGVSGDGETEVFLSVVGMTCQSCVNTIEGALKELPGVIEPSVDLAAGTARVRCSPGALTPRQVADTVYDLGFDVTIVSVDGKQYNENNTPETKSDQGSGDGIKPPSPVKSKTQANGSARARSAPEVWRCTLEVRGMTCASCVAAIEKHCSKIYGVHSINIGLLAAKAEVKYEPRAISAADIAHSITELGFPADVVSDCDGSGQKDLVVVIKGMTCASCVNKIEKAVLKLDGVTA...
AA_position 33
XM_031908154.1 - Galleria mellonella (greater wax moth) - NCBI
PREDICTED: Danaus plexippus plexippus copper-transporting ATPase 2 (LOC116776693), transcript variant X2, mRNA. (3647 bp)
feature by RNAseq alignments, including 9 samples with support for all annotated introns" /db_xref="GeneID:116776693" CDS 67..3552 /gene="LOC116776693" /codon_start=1 /product="copper-transporting ATPase 2 isoform X2" /protein_id="XP_032525839.1" /db_xref="GeneID:116776693" /translation="MTCQSCVRSIEGSVRELPGIHYVKVELSEKAGYFKYDPSACSADSIRSHIEDMGFEVTDNSDGETRNLLNPEIPTDTLIDMSTDASLLLAVVGMTCQSCVDSIQGALKDVPGVTSSTVSLAQGTALVTFTPAEVTPDLIKDTIYNLGFDVDIISVTDKEAENKDQGGSGDRRARAGGGEATAKTNGNAPSEISRCTLEVKGMTCASCVAAIEKHCAKLTGVHSIVIALLAAKAEVRYEPAKISAAAIADSITELGFSSELISDSGAPKDLNLLIKGMTCASCVNKIEKSLMKLTGVVSCSVALTTSKGKVK...
AA_position 1
XM_032669948.1 - Danaus plexippus plexippus - NCBI
PREDICTED: Danaus plexippus plexippus copper-transporting ATPase 2 (LOC116776693), transcript variant X1, mRNA. (3774 bp)
feature by RNAseq alignments, including 9 samples with support for all annotated introns" /db_xref="GeneID:116776693" CDS 67..3606 /gene="LOC116776693" /codon_start=1 /product="copper-transporting ATPase 2 isoform X1" /protein_id="XP_032525838.1" /db_xref="GeneID:116776693" /translation="MTCQSCVRSIEGSVRELPGIHYVKVELSEKAGYFKYDPSACSADSIRSHIEDMGFEVTDNSDGETRNLLNPEIPTDTLIDMSTDASLLLAVVGMTCQSCVDSIQGALKDVPGVTSSTVSLAQGTALVTFTPAEVTPDLIKDTIYNLGFDVDIISVTDKEAENKDQGGSGDRRARAGGGEATAKTNGNAPSEISRCTLEVKGMTCASCVAAIEKHCAKLTGVHSIVIALLAAKAEVRYEPAKISAAAIADSITELGFSSELISDSGAPKDLNLLIKGMTCASCVNKIEKSLMKLTGVVSCSVALTTSKGKVK...
AA_position 1
XM_032669947.1 - Danaus plexippus plexippus - NCBI
PREDICTED: Danaus plexippus plexippus copper-transporting ATPase 2 (LOC116776693), transcript variant X3, mRNA. (4124 bp)
coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:116776693" CDS 321..3956 /gene="LOC116776693" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_032525840.1" /db_xref="GeneID:116776693" /translation="MLSRGVKYKLLEDGDGGDPSPDLVSVRVPIHGMTCQSCVRSIEGSVRELPGIHYVKVELSEKAGYFKYDPSACSADSIRSHIEDMGFEVTDNSDGETRNLLNPEIPTDTLIDMSTDASLLLAVVGMTCQSCVDSIQGALKDVPGVTSSTVSLAQGTALVTFTPAEVTPDLIKDTIYNLGFDVDIISVTDKEAENKDQGGSGDRRARAGGGEATAKTNGNAPSEISRCTLEVKGMTCASCVAAIEKHCAKLTGVHSIVIALLAAKAEVRYEPAKISAAAIADSITELGFSSELISDSGAPKDLNLLIKGMTCASCVNKIEKSLMKLTGVVSCSVALT...
AA_position 33
XM_032669949.1 - Danaus plexippus plexippus - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (4289 bp)
CDS 340..4164 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X5" /protein_id="XP_031540442.1" /db_xref="GeneID:102544967" /translation="MERAGGEKSGSPEPSFLATLADPQVTLLSVHKRWSFRRSPGARGSIRPVTSEEEGCRPEEGGFSQKVLNGTQEIGSDQILSKLPWTARAWEPEMKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGLIDVRRLQSAHPKVPLASSNQNGSNSETSGHRGSQVVTLHLGVDGMHCKSCVLNIEDNIGQLPGVQSIHVSLEDRSAQVQYDPSCISPGALQRAIEALPPGKFKVSLPDGAEESGTEARRHSPGPPQGLPEPGAHWTAVLSIAGMTCMSCVQSIE...
AA_position 127
XM_031684582.1 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Phoca vitulina ATPase copper transporting beta (ATP7B), mRNA. (4628 bp)
and 99% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:116631683" CDS 330..4628 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2" /protein_id="XP_032258982.1" /db_xref="GeneID:116631683" /translation="MKQSFAFDNVGYEGGHDGVCPPQTTSSTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVKYVPSILSLPQICRHIEDMGFEASIAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGRLGKLQGVVRVRVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPIDIGRLQRTDPKTPSASDNQNLNNSEPLGHHGSHVVTLQLRVDGMHCKSCVLNIEENIGQLPGVQNIQVSLENRIAQVQYDPSRITANALQRAIEALPPGDFKVSLPDGAAGGGAGSRSSNRAAPAPAPRTQEPGVCSTVVLAIAGMTCASCVQSIEG...
AA_position 34
XM_032403091.1 - Phoca vitulina (harbor seal) - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (6544 bp)
including 2 samples with support for all annotated introns" /db_xref="GeneID:102544967" CDS 263..4546 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_031540441.1" /db_xref="GeneID:102544967" /translation="MKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGLIDVRRLQSAHPKVPLASSNQNGSNSETSGHRGSQVVTLHLGVDGMHCKSCVLNIEDNIGQLPGVQSIHVSLEDRSAQVQYDPSCISPGALQRAIEALPPGKFKVSLPDGAEESGTEARRHSPGPPQGLPEPGAHWTAVLSIAGMTCMSCVQSIEGLVSQ...
AA_position 34
XM_031684581.1 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Corvus moneduloides ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (4974 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X5" /protein_id="XP_031955582.1" /db_xref="GeneID:116439737" /translation="MERKLDNKMKRELSYLATLNDRNISLVSIRKQQAARDVPELLIIGEKSKTASLVKTSSNLQKEEELPQSYSMGMTEVNTVERQALSNTDSPPDCELKPTMKHNFAFDNMGYEESSETMPSPPSQEHSVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNHAVIKYLQSEISPEQICQEILDMGFDANIAEDKLTTATVNLPSLKEAVVKLRVEGMTCQSCVTSIEGKIRKLHGVAKIKVSLDNQEAIVAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANPRETPASLKSDGLDPLVTEVGSTATVTLQIEGMHCKSCIRNIEGNISDLPGIKSIKVSLEHKCAVVQYTPDFITLSALQQAIESLPPGNFKVTLHNGSEAGKAASPSGAFTYDLIRQPPQGTTLTAVIKIDGMTCNSCVQSIEGAISQRQG...
AA_position 135
XM_032099691.1 - Corvus moneduloides (New Caledonian crow) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X9, mRNA. (6649 bp)
support for all annotated introns" /db_xref="GeneID:101006616" CDS 342..4604 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X6" /protein_id="XP_017806754.3" /db_xref="GeneID:101006616" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLESTNPKRPLSSANQNFNNSETLGHQGRNVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVQYDPSRTSPVALQTAIEALPPGNFKVSLPDGAEGSGTDHRSSSSRSPGSSPRNQVQSTCSTTLIAIAGMTCAS...
AA_position 67
XM_017951265.3 - Papio anubis (olive baboon) - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6485 bp)
samples with support for all annotated introns" /db_xref="GeneID:102544967" CDS 153..4487 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_031540440.1" /db_xref="GeneID:102544967" /translation="MQILSKLPWTARAWEPEMKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGLIDVRRLQSAHPKVPLASSNQNGSNSETSGHRGSQVVTLHLGVDGMHCKSCVLNIEDNIGQLPGVQSIHVSLEDRSAQVQYDPSCISPGALQRAIEALPPGKFKVSLPDGAEESGTEARRHSPGPPQGLPEPGAHWTAVLSIAGMTCMSCVQSIE...
AA_position 51
XM_031684580.1 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Vicugna pacos ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6836 bp)
support for all annotated introns" /db_xref="GeneID:102544967" CDS 456..4838 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X2" /protein_id="XP_031540439.1" /db_xref="GeneID:102544967" /translation="MKPEQERRIIDREEASRRILSKLPWTARAWEPEMKQSFAFDNTGYEDGLDGMYPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVAEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMSLGLIDVRRLQSAHPKVPLASSNQNGSNSETSGHRGSQVVTLHLGVDGMHCKSCVLNIEDNIGQLPGVQSIHVSLEDRSAQVQYDPSCISPGALQRAIEALPPGKFKVSLPDGAEESGTEARRHSPGPPQGLPEPGAHWTAVLSIAGMTCMSCVQ...
AA_position 67
XM_031684579.1 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Hylobates moloch ATPase copper transporting beta (ATP7B), mRNA. (7191 bp)
sample with support for all annotated introns" /db_xref="GeneID:116467307" CDS 750..5147 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2" /protein_id="XP_032006829.1" /db_xref="GeneID:116467307" /translation="MPEQERQITAREGASRKVLSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATMKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAVIKNKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQESHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVQYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSNSHSPGSSPRNQVQGTCSTTLIAIAGMTCA...
AA_position 67
XM_032150938.1 - Hylobates moloch (silvery gibbon) - NCBI
PREDICTED: Lynx canadensis ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (4435 bp)
including 1 sample with support for all annotated introns" /db_xref="GeneID:115510217" CDS 119..4435 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_030165737.1" /db_xref="GeneID:115510217" /translation="MQQKQSFAFDNVGYEGGLDSVCPSQTTTGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVIYVPSVLSLPQVCRHVEDMGFEASITEGKAASWPSRSSSALEATVKLRVEGMTCQSCVSSIEGRLGKLQGVVRARVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPIDIGRLQRTNPKTPLTSGTQNLNNSETLGHQGSRVVTLQLRVDGMHCKSCVLNIEENIGQLPGVQSIQVSLENRIAQVQFDPSRVTPGALQRAIEALPPGNFQVSLPDGAAGSGTDNRPSTHLASAPAPAPAQGTRMQGLGSTVVLAIGGMTCASCVQ...
AA_position 36
XM_030309877.1 - Lynx canadensis (Canada lynx) - NCBI
PREDICTED: Sapajus apella ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (7146 bp)
support for all annotated introns" /db_xref="GeneID:116562360" CDS 710..5098 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_032150439.1" /db_xref="GeneID:116562360" /translation="MPEQERQITAREGASRKILSKLSLPNRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVTTSTIKILGMTCQSCVKSIEDRISSLKGIVSVKVSLEQGSATVNYVPSVLSPQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTYPKRPFTSNQNFNNSETLGHQGNHVVTLQLRIDGMHCTSCILNIEENIGQLPGIQSIQVSLENKTAQVQYDPSCTSPVSLQRAIEALPPGNFKVSLPDGAEGCGTEHRPSGSHSLGFSQRNQAQGTCSTAVIAIAGMTCASC...
AA_position 67
XM_032294548.1 - Sapajus apella (Tufted capuchin) - NCBI
PREDICTED: Sapajus apella ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (7174 bp)
support for all annotated introns" /db_xref="GeneID:116562360" CDS 711..5126 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_032150438.1" /db_xref="GeneID:116562360" /translation="MPEQERQITAREGASRKILSKLSLPNRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVTTSTIKILGMTCQSCVKSIEDRISSLKGIVSVKVSLEQGSATVNYVPSVLSPQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTYPKRPFTSNQNFNNSETLGHQGNHVVTLQLRIDGMHCTSCILNIEENIGQLPGIQSIQVSLENKTAQVQYDPSCTSPVSLQRAIEALPPGNFKVSLPDGAEGCGTEHRPSGSHSLGFSQRNQAQGTCSTAVIAIAGMTCASC...
AA_position 67
XM_032294547.1 - Sapajus apella (Tufted capuchin) - NCBI
PREDICTED: Mustela erminea ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (5141 bp)
including 11 samples with support for all annotated introns" /db_xref="GeneID:116573862" CDS 314..4612 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_032170071.1" /db_xref="GeneID:116573862" /translation="MKQSFAFDNVGYEGGLDTVDPPQTATGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVRYVPSILSLPQICRHIEDMGFEASVAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLSTQEAVITYQPYLIQPQDLRDHVSDMGFEAVIKNKVAPVSLGPIDIGRLQSTNPKTPLASDNQSLNNSETSEHQGSHTVTLQLRVDGMHCTSCVMNIEENIGQLPGVQSVQVSLESRLAQVQYDPSRVTATALQRAIEALPPGNFKVSLPDGVTGNGTGRRSSNRVVPAPTLRPQVQGVCDTVVLAIAGMTCASCAQSIEG...
AA_position 34
XM_032314180.1 - Mustela erminea (ermine) - NCBI
PREDICTED: Mustela erminea ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (5356 bp)
including 43 samples with support for all annotated introns" /db_xref="GeneID:116573862" CDS 529..4827 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_032170070.1" /db_xref="GeneID:116573862" /translation="MKQSFAFDNVGYEGGLDTVDPPQTATGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVRYVPSILSLPQICRHIEDMGFEASVAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLSTQEAVITYQPYLIQPQDLRDHVSDMGFEAVIKNKVAPVSLGPIDIGRLQSTNPKTPLASDNQSLNNSETSEHQGSHTVTLQLRVDGMHCTSCVMNIEENIGQLPGVQSVQVSLESRLAQVQYDPSRVTATALQRAIEALPPGNFKVSLPDGVTGNGTGRRSSNRVVPAPTLRPQVQGVCDTVVLAIAGMTCASCAQSIEG...
AA_position 34
XM_032314179.1 - Mustela erminea (ermine) - NCBI
PREDICTED: Sapajus apella ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (7574 bp)
annotated introns" /db_xref="GeneID:116562360" CDS 1093..5526 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X2" /protein_id="XP_032150437.1" /db_xref="GeneID:116562360" /translation="MTTSHRQNYEVPLKVNLLLFQPFPSCPLAQPQILSKLSLPNRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVTTSTIKILGMTCQSCVKSIEDRISSLKGIVSVKVSLEQGSATVNYVPSVLSPQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTYPKRPFTSNQNFNNSETLGHQGNHVVTLQLRIDGMHCTSCILNIEENIGQLPGIQSIQVSLENKTAQVQYDPSCTSPVSLQRAIEALPPGNFKVSLPDGAEGCGTEHRPSGSHSLGFSQRNQAQGTCSTAVIAIAGMTCASC...
AA_position 82
XM_032294546.1 - Sapajus apella (Tufted capuchin) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X8, mRNA. (6784 bp)
support for all annotated introns" /db_xref="GeneID:101006616" CDS 342..4739 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X5" /protein_id="XP_017806752.3" /db_xref="GeneID:101006616" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLESTNPKRPLSSANQNFNNSETLGHQGRNVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVQYDPSRTSPVALQTAIEALPPGNFKVSLPDGAEGSGTDHRSSSSRSPGSSPRNQVQSTCSTTLIAIAGMTCAS...
AA_position 67
XM_017951263.3 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X7, mRNA. (6680 bp)
support for all annotated introns" /db_xref="GeneID:101006616" CDS 211..4635 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_021785338.2" /db_xref="GeneID:101006616" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLESTNPKRPLSSANQNFNNSETLGHQGRNVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVQYDPSRTSPVALQTAIEALPPGNFKVSLPDGAEGSGTDHRSSSSRSPGSSPRNQVQSTCSTTLIAIAGMTCAS...
AA_position 67
XM_021929646.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (6812 bp)
support for all annotated introns" /db_xref="GeneID:101006616" CDS 343..4767 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_021785336.2" /db_xref="GeneID:101006616" /translation="MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLESTNPKRPLSSANQNFNNSETLGHQGRNVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVQYDPSRTSPVALQTAIEALPPGNFKVSLPDGAEGSGTDHRSSSSRSPGSSPRNQVQSTCSTTLIAIAGMTCAS...
AA_position 67
XM_021929644.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Coturnix japonica ATPase copper transporting beta (ATP7B), transcript variant X6, mRNA. (4724 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X5" /protein_id="XP_032297997.1" /db_xref="GeneID:107308183" /translation="MERKLDNKTRRELSCLATLNNKNITLVSIRKRQAAHDVPELLIIEGSKAGSPLEASSNLQKEEKVLQRNSMGMPEGNATGRQVLSNADSPPSCALESEMKQNFAFDNMGYEENCEAMPSSSSQERTVVVNVVGMTCQSCVQSVEGRISKVKGVVSIKVSLELNNALVKYLQSEISPEQICQEIEDMGFDANIAEERLTPVSVNLPCSREAVIKLRIEGMTCQSCVTSIEGKIKKLHGVAKIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTIKSKSAPLKLGVLDVRSLQSADPKETPASLEGEGLHPLVANKSSTATVTVHIEGMHCKSCVRNIEGNISSLPGIQSIEVSLEHKWAVVQYSPNLITLPALQQAIESLPPGNFKVYLPNSSEANNQASSSPALVCDLFREPLKDTVCTAVIRIDGMTCNSCVQSIEGTISQRQGV...
AA_position 134
XM_032442106.1 - Coturnix japonica (Japanese quail) - NCBI
PREDICTED: Sapajus apella ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (7601 bp)
annotated introns" /db_xref="GeneID:116562360" CDS 1093..5553 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X1" /protein_id="XP_032150436.1" /db_xref="GeneID:116562360" /translation="MTTSHRQNYEVPLKVNLLLFQPFPSCPLAQPQILSKLSLPNRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVTTSTIKILGMTCQSCVKSIEDRISSLKGIVSVKVSLEQGSATVNYVPSVLSPQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLQSTYPKRPFTSNQNFNNSETLGHQGNHVVTLQLRIDGMHCTSCILNIEENIGQLPGIQSIQVSLENKTAQVQYDPSCTSPVSLQRAIEALPPGNFKVSLPDGAEGCGTEHRPSGSHSLGFSQRNQAQGTCSTAVIAIAGMTCASC...
AA_position 82
XM_032294545.1 - Sapajus apella (Tufted capuchin) - NCBI
PREDICTED: Papio anubis ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (7465 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X2" /protein_id="XP_031511724.1" /db_xref="GeneID:101006616" /translation="MDSAMEKARGDVPQSPEQSFLATLSDPHVTLLSVHKQWSFRKSPGVRHSARPVSTMEEGTSLSEEGEFPQRVLNGTWKMSSNQILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVDTSTIRILGMTCQSCVKSIEDRISSLKGIVSMKVSLEQGSATVKYVPSVVSLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVGSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKNKVAPLSLGPIDIERLESTNPKRPLSSANQNFNNSETLGHQGRNVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVQYDPSRTSPVALQTAIEALPPGNFKVSLPDGAEGSGTDHRSSSSRSPGSSPRNQVQSTCSTTLIAIAGMTCASCVHTIEGMISQL...
AA_position 133
XM_031655864.1 - Papio anubis (olive baboon) - NCBI
PREDICTED: Camelus dromedarius ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (4557 bp)
including 3 samples with support for all annotated introns" /db_xref="GeneID:105090992" CDS 267..4550 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_031321815.1" /db_xref="GeneID:105090992" /translation="MKQSFAFDNTGYEDGLDGMCPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVVEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMNLGLIDVRRLQSAHPNVPLASSNQNGSNSETSGHRGSQVVTLHLGVDGMHCKSCVLNIEDNIGQLPGVQSIHVSLEDRSAQVQYDPSCISPGALQRAIEALPPGKFKVSLPDGAEESGTEARRRSPGPPKGLPEPGAHWTAVLSIAGMTCMSCVQSIEGLVSQ...
AA_position 34
XM_031465955.1 - Camelus dromedarius (Arabian camel) - NCBI
PREDICTED: Mustela erminea ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (7164 bp)
CDS 321..4790 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_032170069.1" /db_xref="GeneID:116573862" /translation="MVGKGVTVDTAMEEAGGETPRSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGARGSSRPVTSEEEGECSQKVLNGTRGIRSNQILSKLSLPARAREPAMKQSFAFDNVGYEGGLDTVDPPQTATGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVRYVPSILSLPQICRHIEDMGFEASVAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLSTQEAVITYQPYLIQPQDLRDHVSDMGFEAVIKNKVAPVSLGPIDIGRLQSTNPKTPLASDNQSLNNSETSEHQGSHTVTLQLRVDGMHCTSCVMNIEENIGQLPGVQSVQVSLESRLAQVQYDPSRVTATALQRAIEALPPGNFKVSLPDGVTGNGTGRRSSNRVVPAPTLRPQVQGVCDTVVLAIAGMTC...
AA_position 132
XM_032314178.1 - Mustela erminea (ermine) - NCBI
PREDICTED: Corvus moneduloides ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (6355 bp)
including 2 samples with support for all annotated introns" /db_xref="GeneID:116439737" CDS 188..4486 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_031955581.1" /db_xref="GeneID:116439737" /translation="MKHNFAFDNMGYEESSETMPSPPSQEHSVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNHAVIKYLQSEISPEQICQEILDMGFDANIAEDKLTTATVNLPSLKEAVVKLRVEGMTCQSCVTSIEGKIRKLHGVAKIKVSLDNQEAIVAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANPRETPASLKSDGLDPLVTEVGSTATVTLQIEGMHCKSCIRNIEGNISDLPGIKSIKVSLEHKCAVVQYTPDFITLSALQQAIESLPPGNFKVTLHNGSEAGKAASPSGAFTYDLIRQPPQGTTLTAVIKIDGMTCNSCVQSIEGAIS...
AA_position 36
XM_032099690.1 - Corvus moneduloides (New Caledonian crow) - NCBI
PREDICTED: Camelus dromedarius ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (4496 bp)
samples with support for all annotated introns" /db_xref="GeneID:105090992" CDS 155..4489 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_031321814.1" /db_xref="GeneID:105090992" /translation="MQILSKLSWTARAWEPEMKQSFAFDNTGYEDGLDGMCPSQTATGTISIAGMTCQSCVQSIEGRVSSLKGIVSIKVSLEQGSAAVKYVPSVLSLPQVCSHIEDMGFEASVVEGKAASWPYRSSPVPEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLGSREAVITYQPYLIQPQELRDHVNDMGFEAIIKNKGAPMNLGLIDVRRLQSAHPNVPLASSNQNGSNSETSGHRGSQVVTLHLGVDGMHCKSCVLNIEDNIGQLPGVQSIHVSLEDRSAQVQYDPSCISPGALQRAIEALPPGKFKVSLPDGAEESGTEARRRSPGPPKGLPEPGAHWTAVLSIAGMTCMSCVQSIE...
AA_position 51
XM_031465954.1 - Camelus dromedarius (Arabian camel) - NCBI
PREDICTED: Mustela erminea ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6827 bp)
CDS 321..4814 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X2" /protein_id="XP_032170068.1" /db_xref="GeneID:116573862" /translation="MVGKGVTVDTAMEEAGGETPRSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGARGSSRPVTSEEEGECSQKVLNGTRGIRSNQILSKLSLPARAREPAMKQSFAFDNVGYEGGLDTVDPPQTATGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVRYVPSILSLPQICRHIEDMGFEASVAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLSTQEAVITYQPYLIQPQDLRDHVSDMGFEAVIKNKVAPVSLGPIDIGRLQSTNPKTPLASDNQSLNNSETSEHQGSHTVTLQLRVDGMHCTSCVMNIEENIGQLPGVQSVQVSLESRLAQVQYDPSRVTATALQRAIEALPPGNFKVSLPDGVTGNGTGRRSSNRVVPAPTLRPQVQGVCDTVVLAIAGMTC...
AA_position 132
XM_032314177.1 - Mustela erminea (ermine) - NCBI
PREDICTED: Lynx canadensis ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (4706 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_030165720.1" /db_xref="GeneID:115510217" /translation="MVGKGVTVDTAMEKAGGDTPGSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGTGGSTRPVTSEEEGEFSQKVLNGTRGIRSNQILSKHSLPARVWEPAMQQKQSFAFDNVGYEGGLDSVCPSQTTTGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVIYVPSVLSLPQVCRHVEDMGFEASITEGKAASWPSRSSSALEATVKLRVEGMTCQSCVSSIEGRLGKLQGVVRARVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPIDIGRLQRTNPKTPLTSGTQNLNNSETLGHQGSRVVTLQLRVDGMHCKSCVLNIEENIGQLPGVQSIQVSLENRIAQVQFDPSRVTPGALQRAIEALPPGNFQVSLPDGAAGSGTDNRPSTHLASAPAPAPAQGTRMQGLGSTVVLAIGGMTCASCVQSIEG...
AA_position 134
XM_030309860.1 - Lynx canadensis (Canada lynx) - NCBI
PREDICTED: Lynx canadensis ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (5781 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X1" /protein_id="XP_030165702.1" /db_xref="GeneID:115510217" /translation="MVGKGVTVDTAMEKAGGDTPGSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGTGGSTRPVTSEEEGEFSQKVLNGTRGIRSNQILSKHSLPARVWEPAMQQKQSFAFDNVGYEGGLDSVCPSQTTTGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVIYVPSVLSLPQVCRHVEDMGFEASITEGKAASWPSRSSSALEATVKLRVEGMTCQSCVSSIEGRLGKLQGVVRARVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPIDIGRLQRTNPKTPLTSGTQNLNNSETLGHQGSRVVTLQLRVDGMHCKSCVLNIEENIGQLPGVQSIQVSLENRIAQVQFDPSRVTPGALQRAIEALPPGNFQVSLPDGAAGSGTDNRPSTHLASAPAPAPAQGTRMQGLGSTVVLAIGGMTCASCVQSIEG...
AA_position 134
XM_030309842.1 - Lynx canadensis (Canada lynx) - NCBI
PREDICTED: Aythya fuligula ATPase copper transporting beta (ATP7B), mRNA. (5331 bp)
CDS 14..4600 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2" /protein_id="XP_032063818.1" /db_xref="GeneID:116502163" /translation="MERKGESKIRRELSCLATLNNKNITLVSIRKRQAARDVPELLIIGEKPRAGSPVEASSNLQKEEKVLQSNSMGMPEVNTIERQALSDTDSPPSCALEPTMKQHFAFDNMGYEESFETLPSPSSQERTVAVRVVGMTCQSCVQSVEGRISKVKGVVSIKVSLEQNNALVKYLQSEISPEQICQEIHDMGFDANVAEKRLTPASVSLPCSREAVIKLRIEGMTCQSCVTSIEGKMKKLHGVAKIKVSLANQEAIIAYQPYIIQPEELKSHISSLGYDCTIKSKSAPLKLSVLDLGRLQSADPKETPASLESDGLEPQAARMGGTATVAVQIEGMHCKSCVRNIEGNISSLPGVQSINVSLERKCAVVRYSPNLITLSALQRAIESLPPGNFKVRLPNDSEANNQPSPPPALPCGLAGEPLDDTTCTAVIRIDGMTCNSCVQSIEGTISQ...
AA_position 135
XM_032207927.1 - Aythya fuligula (tufted duck) - NCBI
PREDICTED: Lynx canadensis ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (5723 bp)
CDS 1..4611 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X2" /protein_id="XP_030165712.1" /db_xref="GeneID:115510217" /translation="MVGKGVTVDTAMEKAGGDTPGSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGTGGSTRPVTSEEEGEFSQKVLNGTRGIRSNQILSKHSLPARVWEPAMQQKQSFAFDNVGYEGGLDSVCPSQTTTGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVIYVPSVLSLPQVCRHVEDMGFEASITEGKAASWPSRSSSALEATVKLRVEGMTCQSCVSSIEGRLGKLQGVVRARVSLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPIDIGRLQRTNPKTPLTSGTQNLNNSETLGHQGSRVVTLQLRVDGMHCKSCVLNIEENIGQLPGVQSIQVSLENRIAQVQFDPSRVTPGALQRAIEALPPGNFQVSLPDGAAGSGTDNRPSTHLASAPAPAPAQGTRMQGLGSTVVLAIG...
AA_position 134
XM_030309852.1 - Lynx canadensis (Canada lynx) - NCBI
PREDICTED: Meleagris gallopavo ATPase copper transporting beta (ATP7B), transcript variant X7, mRNA. (5953 bp)
including 23 samples with support for all annotated introns" /db_xref="GeneID:100541545" CDS 73..4476 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X7" /protein_id="XP_019467671.1" /db_xref="GeneID:100541545" /translation="MKQNFAFDNMGYEETFEAMPSSSSQERTVAVNVVGMTCQSCVQSIEGRISKVKGVVSIKVSLELNNALVKYLQSEISPEQICQEIEDMGFDANVAEERLTPVSVNLPCSREAVMKLRIEGMTCQSCVTSIEGKIKKLHGVAKIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTIKSKSAPLKLGVLDVRNLQSADPKKTPASLESEGLHPLIANNSSTATVTVHIEGMHCKSCVRNIEGNISSLPGIQSIEVSLEHKCAVVQYSPNLITLPALQQAIESLPPGNFKVCLPNTSEANNQASPSPALVCDLFREPLKDTMCTAVIRIDGMTCNSCVQSIEGTIS...
AA_position 36
XM_019612126.2 - Meleagris gallopavo (turkey) - NCBI
PREDICTED: Corvus moneduloides ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6328 bp)
support for all annotated introns" /db_xref="GeneID:116439737" CDS 62..4459 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_031955580.1" /db_xref="GeneID:116439737" /translation="MPGTVFSGRNLRSFIYTALSNTDSPPDCELKPTMKHNFAFDNMGYEESSETMPSPPSQEHSVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNHAVIKYLQSEISPEQICQEILDMGFDANIAEDKLTTATVNLPSLKEAVVKLRVEGMTCQSCVTSIEGKIRKLHGVAKIKVSLDNQEAIVAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANPRETPASLKSDGLDPLVTEVGSTATVTLQIEGMHCKSCIRNIEGNISDLPGIKSIKVSLEHKCAVVQYTPDFITLSALQQAIESLPPGNFKVTLHNGSEAGKAASPSGAFTYDLIRQPPQGTTLTAVIKIDGMTCNSCVQ...
AA_position 69
XM_032099689.1 - Corvus moneduloides (New Caledonian crow) - NCBI
PREDICTED: Coturnix japonica ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (12057 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X1" /protein_id="XP_032297996.1" /db_xref="GeneID:107308183" /translation="MERKLDNKTRRELSCLATLNNKNITLVSIRKRQAAHDVPELLIIEGSKAGSPLEASSNLQKEEKVLQRNSMGMPEGNATGRQVLSNADSPPSCALESEMKQNFAFDNMGYEENCEAMPSSSSQERTVVVNVVGMTCQSCVQSVEGRISKVKGVVSIKVSLELNNALVKYLQSEISPEQICQEIEDMGFDANIAEERLTPVSVNLPCSREAVIKLRIEGMTCQSCVTSIEGKIKKLHGVAKIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTIKSKSAPLKLGVLDVRSLQSADPKETPASLEGEGLHPLVANKSSTATVTVHIEGMHCKSCVRNIEGNISSLPGIQSIEVSLEHKWAVVQYSPNLITLPALQQAIESLPPGNFKVYLPNSSEANNQASSSPALVCDLFREPLKDTVCTAVIRIDGMTCNSCVQSIEGTISQRQGV...
AA_position 134
XM_032442105.1 - Coturnix japonica (Japanese quail) - NCBI
PREDICTED: Chiroxiphia lanceolata ATPase copper transporting beta (ATP7B), transcript variant X5, mRNA. (6820 bp)
including 1 sample with support for all annotated introns" /db_xref="GeneID:116782376" CDS 440..4768 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X5" /protein_id="XP_032534829.1" /db_xref="GeneID:116782376" /translation="MKHNFAFDNMGYEESFETTPSSSSQERTVTINIVGMTCQSCVQAIEGRISKVKGIVSIKVSREQNNAVIKYLQLEISPDQICLEIQDMGFDASIAEEKLTTATINLSSLKEAVVKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKRHINNLGYDCTIKSKSAPLKLGVLDLQRLQNANPEKTPASFEGDGLDPLVAEMSSTATVTVQIEGMHCKSCVRNIEENISAIPGIKSIKVSLEQKCAVVEYSPNLITLSALQQAIESLPPENFKVCLLSGSEANKGASPSPAFTGDLIKQPLQDPTCMVVIKIDGMTCNSCAQSIEGTISE...
AA_position 36
XM_032678938.1 - Chiroxiphia lanceolata (lance-tailed manakin) - NCBI
PREDICTED: Mustela erminea ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (5621 bp)
CDS 500..5092 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X1" /protein_id="XP_032170067.1" /db_xref="GeneID:116573862" /translation="MVGKGVTVDTAMEEAGGETPRSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGARGSSRPVTSEEEGECSQKVLNGTRGIRSNQILSKLSLPARAREPAMKQSFAFDNVGYEGGLDTVDPPQTATGTISISGMTCQSCVKSIEGRISSLKGIVSIKVSLEQGSATVRYVPSILSLPQICRHIEDMGFEASVAEGKAASWPSRSSPGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRVSLSTQEAVITYQPYLIQPQDLRDHVSDMGFEAVIKNKVAPVSLGPIDIGRLQSTNPKTPLASDNQSLNNSETSEHQGSHTVTLQLRVDGMHCTSCVMNIEENIGQLPGVQSVQVSLESRLAQVQYDPSRVTATALQRAIEALPPGNFKVSLPDGVTGNGTGRRSSNRVVPAPTLRPQVQGVCDTVVLAIAGMTC...
AA_position 132
XM_032314176.1 - Mustela erminea (ermine) - NCBI
PREDICTED: Chiroxiphia lanceolata ATPase copper transporting beta (ATP7B), transcript variant X4, mRNA. (6849 bp)
for all annotated introns" /db_xref="GeneID:116782376" CDS 358..4797 /gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X4" /protein_id="XP_032534828.1" /db_xref="GeneID:116782376" /translation="MMKFVFLLTDFKRSSWSLPWKALSNTDSPPGCELEPTMKHNFAFDNMGYEESFETTPSSSSQERTVTINIVGMTCQSCVQAIEGRISKVKGIVSIKVSREQNNAVIKYLQLEISPDQICLEIQDMGFDASIAEEKLTTATINLSSLKEAVVKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKRHINNLGYDCTIKSKSAPLKLGVLDLQRLQNANPEKTPASFEGDGLDPLVAEMSSTATVTVQIEGMHCKSCVRNIEENISAIPGIKSIKVSLEQKCAVVEYSPNLITLSALQQAIESLPPENFKVCLLSGSEANKGASPSPAFTGDLIKQPLQDPTCMVVIKIDGMTCNSCAQSIE...
AA_position 73
XM_032678937.1 - Chiroxiphia lanceolata (lance-tailed manakin) - NCBI
PREDICTED: Chiroxiphia lanceolata ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6747 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_032534827.1" /db_xref="GeneID:116782376" /translation="MERKQDSKMKRELSYLATLNDRNITLMSIRKQQAAHDVPELLIIGEKSKTGSPVKASSNLQKEEKLLQSYSMGMPEVNTVERQALSNTDSPPGCELEPTMKHNFAFDNMGYEESFETTPSSSSQERTVTINIVGMTCQSCVQAIEGRISKVKGIVSIKVSREQNNAVIKYLQLEISPDQICLEIQDMGFDASIAEEKLTTATINLSSLKEAVVKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKRHINNLGYDCTIKSKSAPLKLGVLDLQRLQNANPEKTPASFEGDGLDPLVAEMSSTATVTVQIEGMHCKSCVRNIEENISAIPGIKSIKVSLEQKCAVVEYSPNLITLSALQQAIESLPPENFKVCLLSGSEANKGASPSPAFTGDLIKQPLQDPTCMVVIKIDGMTCNSCAQSIEGTISERQG...
AA_position 135
XM_032678936.1 - Chiroxiphia lanceolata (lance-tailed manakin) - NCBI
PREDICTED: Corvus moneduloides ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6714 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X2" /protein_id="XP_031955579.1" /db_xref="GeneID:116439737" /translation="MERKLDNKMKRELSYLATLNDRNISLVSIRKQQAARDVPELLIIGEKSKTASLVKTSSNLQKEEELPQSYSMGMTEVNTVERQALSNTDSPPDCELKPTMKHNFAFDNMGYEESSETMPSPPSQEHSVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNHAVIKYLQSEISPEQICQEILDMGFDANIAEDKLTTATVNLPSLKEAVVKLRVEGMTCQSCVTSIEGKIRKLHGVAKIKVSLDNQEAIVAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANPRETPASLKSDGLDPLVTEVGSTATVTLQIEGMHCKSCIRNIEGNISDLPGIKSIKVSLEHKCAVVQYTPDFITLSALQQAIESLPPGNFKVTLHNGSEAGKAASPSGAFTYDLIRQPPQGTTLTAVIKIDGMTCNSCVQSIEGAISQRQG...
AA_position 135
XM_032099688.1 - Corvus moneduloides (New Caledonian crow) - NCBI
PREDICTED: Corvus moneduloides ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (6736 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X1" /protein_id="XP_031955578.1" /db_xref="GeneID:116439737" /translation="MERKLDNKMKRELSYLATLNDRNISLVSIRKQQAARDVPELLIIGEKSKTASLVKTSSNLQKEEELPQSYSMGMTEVNTVERQALSNTDSPPDCELKPTMKHNFAFDNMGYEESSETMPSPPSQEHSVVVNIVGMTCQSCVQSIEGQISKVKGILRIKVSLEQNHAVIKYLQSEISPEQICQEILDMGFDANIAEDKLTTATVNLPSLKEAVVKLRVEGMTCQSCVTSIEGKIRKLHGVAKIKVSLDNQEAIVAYHPYIIQPDDLKRHISDLGYDCTIKSKSAPLKLGALDLQRLQNANPRETPASLKSDGLDPLVTEVGSTATVTLQIEGMHCKSCIRNIEGNISDLPGIKSIKVSLEHKCAVVQYTPDFITLSALQQAIESLPPGNFKVTLHNGSEAGKAASPSGAFTYDLIRQPPQGTTLTAVIKIDGMTCNSCVQSIEGAISQRQG...
AA_position 135
XM_032099687.1 - Corvus moneduloides (New Caledonian crow) - NCBI
PREDICTED: Meleagris gallopavo ATPase copper transporting beta (ATP7B), transcript variant X3, mRNA. (6269 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X3" /protein_id="XP_019467670.1" /db_xref="GeneID:100541545" /translation="MERKLDNKMRRELSCLATLNNKNITLVSIRKQQAAHDVPELLIIGEGSKAGSLLEASSNLQKEEKVLQRNSMGMPEVNTTGRQVLSNADSPPSCALEPEMKQNFAFDNMGYEETFEAMPSSSSQERTVAVNVVGMTCQSCVQSIEGRISKVKGVVSIKVSLELNNALVKYLQSEISPEQICQEIEDMGFDANVAEERLTPVSVNLPCSREAVMKLRIEGMTCQSCVTSIEGKIKKLHGVAKIKVSLSNQEAVIAYHPYIIQPEELRSHISNLGYDCTIKSKSAPLKLGVLDVRNLQSADPKKTPASLESEGLHPLIANNSSTATVTVHIEGMHCKSCVRNIEGNISSLPGIQSIEVSLEHKCAVVQYSPNLITLPALQQAIESLPPGNFKVCLPNTSEANNQASPSPALVCDLFREPLKDTMCTAVIRIDGMTCNSCVQSIEGTISQRQG...
AA_position 135
XM_019612125.2 - Meleagris gallopavo (turkey) - NCBI
PREDICTED: Chiroxiphia lanceolata ATPase copper transporting beta (ATP7B), transcript variant X2, mRNA. (6895 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X2" /protein_id="XP_032534825.1" /db_xref="GeneID:116782376" /translation="MERKQDSKMKRELSYLATLNDRNITLMSIRKQQAAHDVPELLIIGEKSKTGSPVKASSNLQKEEKLLQSYSMGMPEVNTVERQALSNTDSPPGCELEPTMKHNFAFDNMGYEESFETTPSSSSQERTVTINIVGMTCQSCVQAIEGRISKVKGIVSIKVSREQNNAVIKYLQLEISPDQICLEIQDMGFDASIAEEKLTTATINLSSLKEAVVKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKRHINNLGYDCTIKSKSAPLKLGVLDLQRLQNANPEKTPASFEGDGLDPLVAEMSSTATVTVQIEGMHCKSCVRNIEENISAIPGIKSIKVSLEQKCAVVEYSPNLITLSALQQAIESLPPENFKVCLLSGSEANKGASPSPAFTGDLIKQPLQDPTCMVVIKIDGMTCNSCAQSIEGTISERQG...
AA_position 135
XM_032678934.1 - Chiroxiphia lanceolata (lance-tailed manakin) - NCBI
PREDICTED: Chiroxiphia lanceolata ATPase copper transporting beta (ATP7B), transcript variant X1, mRNA. (6929 bp)
gene="ATP7B" /codon_start=1 /product="copper-transporting ATPase 2 isoform X1" /protein_id="XP_032534824.1" /db_xref="GeneID:116782376" /translation="MERKQDSKMKRELSYLATLNDRNITLMSIRKQQAAHDVPELLIIGEKSKTGSPVKASSNLQKEEKLLQSYSMGMPEVNTVERQALSNTDSPPGCELEPTMKHNFAFDNMGYEESFETTPSSSSQERTVTINIVGMTCQSCVQAIEGRISKVKGIVSIKVSREQNNAVIKYLQLEISPDQICLEIQDMGFDASIAEEKLTTATINLSSLKEAVVKLRVEGMTCQSCVTNIEGKIRKLHGVAKIKVSLGNQEAIIAYYPYIIQPDDLKRHINNLGYDCTIKSKSAPLKLGVLDLQRLQNANPEKTPASFEGDGLDPLVAEMSSTATVTVQIEGMHCKSCVRNIEENISAIPGIKSIKVSLEQKCAVVEYSPNLITLSALQQAIESLPPENFKVCLLSGSEANKGASPSPAFTGDLIKQPLQDPTCMVVIKIDGMTCNSCAQSIEGTISERQG...
AA_position 135
XM_032678933.1 - Chiroxiphia lanceolata (lance-tailed manakin) - NCBI
PREDICTED: Bicyclus anynana copper-transporting ATPase 1-like (LOC112049653), mRNA. (732 bp)
coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:112049653" CDS 283..732 /gene="LOC112049653" /codon_start=1 /product="copper-transporting ATPase 1-like" /protein_id="XP_023943402.1" /db_xref="GeneID:112049653" /translation="MATECETSEMLATEAEKEGAQELVGVRVPINGMTCQSCVRSIEGSVRDLPGIHHVKVELSEHAGYFRYDPRVCSVEAIRAHIEDMGFDAPAGTADDETRNLLPREIPTDLLIDMTGSGPPRETTALVSVTGMTCQSCVNTIEGEHGMKS" misc_feature 364..549 /gene="LOC112049653" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport...
AA_position 33
XM_024087634.1 - Bicyclus anynana (squinting bush brown) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/MTCQSC
lang : en | div : | spe : | query_string : MTCQSC | format : html | download :

0.000 | 0.000 | search_start;
0.080 | 0.080 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:MTCQSC)%7C(nt:MTCQSC)%7C(aa:MTCQSC))?to=0&format=json
0.223 | 0.142 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:MTCQSC)%7C(nt:MTCQSC)%7C(aa:MTCQSC))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.228 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]