GGRNA ver.2 Help | Advanced search | English    旧バージョン

2021-12-06 05:21:53, GGRNA : RefSeq release 208 (Sep, 2021)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

PREDICTED: Xenopus laevis claudin 1 S homeolog (cldn1.S), transcript variant X1, mRNA. (1522 bp)
LOCUS XM_041563893 1522 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 1 S homeolog (cldn1.S), transcript variant X1, mRNA. ACCESSION XM_041563893 VERSION XM_041563893.1 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-1; cld1; cldn1; ilvasc; semp1
XM_041563893.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Xenopus laevis claudin 18 L homeolog (cldn18.L), transcript variant X2, mRNA. (2529 bp)
LOCUS XM_041562121 2529 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 18 L homeolog (cldn18.L), transcript variant X2, mRNA. ACCESSION XM_041562121 VERSION XM_041562121.1 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-18; cldn18
XM_041562121.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Xenopus laevis claudin 18 L homeolog (cldn18.L), transcript variant X1, mRNA. (2563 bp)
LOCUS XM_041562120 2563 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 18 L homeolog (cldn18.L), transcript variant X1, mRNA. ACCESSION XM_041562120 VERSION XM_041562120.1 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-18; cldn18
XM_041562120.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Xenopus laevis claudin 19 L homeolog (cldn19.L), transcript variant X1, mRNA. (1055 bp)
LOCUS XM_018224573 1055 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis claudin 19 L homeolog (cldn19.L), transcript variant X1, mRNA. ACCESSION XM_018224573 VERSION XM_018224573.2 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: claudin-19
XM_018224573.2 - Xenopus laevis (African clawed frog) - NCBI
Gallus gallus claudin 1 (CLDN1), mRNA. (2578 bp)
note="claudin 1" /db_xref="CGNC:66478" /db_xref="GeneID:424910" exon 1..301 /gene="CLDN1" /inference="alignment:Splign:2.1.0" CDS 79..714 /gene="CLDN1" /note="tight junction protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001013629.1" /db_xref="CGNC:66478" /db_xref="GeneID:424910" /translation="MASGGLQLLGFVLAFLGWMGIIISTAMPQWKMASYAGDNIVTAQALYEGLWMSCAMQSTGQIQCKVYDSLLKLEGSLQATRALMVAAILLGLVGVFVAVTGMKCMKCMEDDQVKKMRMAVFGGVIFIIAGLSALVATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLALLGGAFLCCSCPRSETSYPPSRGYPKNAPSTGKDYV" misc_feature 91..624 /gene="CLDN1" /note="PMP-22/EMP/MP20/Claudin family;...
NM_001013611.2 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Betta splendens claudin e (cldne), mRNA. (1150 bp)
genomic feature by RNAseq alignments" /db_xref="GeneID:114868049" CDS 105..737 /gene="cldne" /codon_start=1 /product="claudin e" /protein_id="XP_029027189.1" /db_xref="GeneID:114868049" /translation="MVSMGKQILGFALALFGFLAAIITCGLPMWKVTAFIGANIVTAQTIWEGLWMNCVMQSTGQMQCKIYDSMLALPQDLQAARALVVIAIVIAIFGIILGIAGGKCTNFVEDEYSKAKVAIAAGAVFIAAGVLVLVPVCWSANTIIRDFYNPILTDAQRREIGASLYIGWGSAALLILGGALLCASCPRKDSPEYPVKYGGPRSVAESRAYV" misc_feature 114..608 /gene="cldne" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029171356.1 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Microtus oregoni claudin 9 (Cldn9), mRNA. (654 bp)
includes similarity to: 28 Proteins" /db_xref="GeneID:121463937" CDS 1..654 /gene="Cldn9" /codon_start=1 /product="claudin-9" /protein_id="XP_041532449.1" /db_xref="GeneID:121463937" /translation="MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 10..489 /gene="Cldn9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_041676515.1 - Microtus oregoni (creeping vole) - NCBI
PREDICTED: Betta splendens claudin k (cldnk), mRNA. (906 bp)
genomic feature by RNAseq alignments" /db_xref="GeneID:114860584" CDS 1..648 /gene="cldnk" /codon_start=1 /product="claudin k" /protein_id="XP_029015101.1" /db_xref="GeneID:114860584" /translation="MATTGMQLLGLILSLVGWVGGAVVCAIPLWRVTAFIGNNIVTAQIIWEGLWMNCIVQSTGQIQCKVYDSLLALPSDMQAARGLTVFSILLSGLALALGVLGVKCTKCIGINSLKARVARISGALFAIAGFLYLVPICWTAHSIIRDFYDPHVAAPHKRELGPALYIGWGASALLLIGGSLLYAGSSPPGIPGSPTFSSGESSPRRAPATQVKGYV" misc_feature 10..543 /gene="cldnk" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029159268.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 10d (cldn10d), mRNA. (833 bp)
alignments" /db_xref="GeneID:114848315" CDS 63..833 /gene="cldn10d" /codon_start=1 /product="claudin-10" /protein_id="XP_028994564.1" /db_xref="GeneID:114848315" /translation="MQHRTMVMYMEIGCFVSSLSGWMLVCSTLPLDYWSYSEDLQNVLTTGDYYFNLWRDCVLDGTGAVDCKEYPSMLALSAFLHACRALTISAVIVGFFGSVLTLIGMKCTKLGGSEVANARVTFSGGITYLVSGFCGMITYSMWANKTINEFVNPQFMDLKNELGAAIFIGWGGSVLLILGGAALIYFSGKEALPSNSQAVPKRPVSYATARTRCTYRLPASASRVSLVPPLLYEGRQSRTTRTTIKTGRAYSQDSFV" misc_feature 84..602 /gene="cldn10d" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029138731.1 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114869431), mRNA. (1815 bp)
by RNAseq alignments" /db_xref="GeneID:114869431" CDS 999..1631 /gene="LOC114869431" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029029505.1" /db_xref="GeneID:114869431" /translation="MASAGKQTLAVALAVLGFVGSIIVCGLPMWTVSAFVGANIVTSQTTWEGLWMNCVTQSTGQMQCKIYDSFLALPAELQAARAFSVAAVIAGLLGVVLAVAGAKCTTFIGDETQKCRAAIAAGAVLLVSGLLVLVPVCWTATAVVRNFYSGATADAQRRELGPALYVGWGVAVGLVLSGGLLCTSCPRGDDDHYDVEYAKARSVGASGDSV" misc_feature 1011..1541 /gene="LOC114869431" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173672.1 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 29 (cldn29), mRNA. (1368 bp)
feature by RNAseq alignments" /db_xref="GeneID:114869428" CDS 533..1165 /gene="cldn29" /codon_start=1 /product="claudin-4" /protein_id="XP_029029501.1" /db_xref="GeneID:114869428" /translation="MASLGLQILGIGLAVLGWIGNILICMLPLWKVSAFVGNNIVVAQTIWEGLWMTCVVQSTGQMQCKVYDSLLALPPDLQAARAMVVIAILLSLFGLLLSVVGGKCTTCVGDKAAKARVAISAGVFFVLSGALCLVTVSLPANTVIKDFYNPLVPDAQRRELGACLYVGWGASGLLLIGGALLCCQCPPREDRYAGAKYTPPKSTTPGKEFV" misc_feature 545..1042 /gene="cldn29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173668.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 5a (cldn5a), mRNA. (2336 bp)
feature by RNAseq alignments" /db_xref="GeneID:114861654" CDS 857..1504 /gene="cldn5a" /codon_start=1 /product="claudin 5a" /protein_id="XP_029016950.1" /db_xref="GeneID:114861654" /translation="MVSAALELLGLSLCVIGSLLVMVACGLPMWKVTAFIEANIVVAQTIWDGLWMSCVVQSTGQMQCKVHDSVLALSHDLQAARALTIISCVMGVLGLMVVIAGAQCTNCIRAETIKARVVNAGGIIYIASGLFVLVPLCWMANNIISDFYNPQVPTAKKREIGAALYIGWAATALLLIGGAILCCSCPSSGNSGYSVNYAQTKRATQNGEYDKRNYV" misc_feature 869..1399 /gene="cldn5a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029161117.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Pyrgilauda ruficollis claudin 3 (CLDN3), mRNA. (645 bp)
includes similarity to: 70 Proteins" /db_xref="GeneID:121362955" CDS 1..645 /gene="CLDN3" /codon_start=1 /product="claudin-3" /protein_id="XP_041340840.1" /db_xref="GeneID:121362955" /translation="MSMGLEIGGVALSVLGWLCSIICCALPMWKVSAFIGNNIVTAQILWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALLVVAIILAVLGLMVAIVGAQCTRCVEDESTKAKITIVSGVIFLLSGVMTLIPVCWSANTIIRDFYNPLVIEAQKRELGTSLYVGWAASALLLLGGGLLCCSCPPKDDRYPTGKVAYSAPRSAVTSYDKRNYV" misc_feature 7..501 /gene="CLDN3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_041484906.1 - Pyrgilauda ruficollis (rufous-necked snowfinch) - NCBI
PREDICTED: Betta splendens claudin 26 (cldn26), mRNA. (2026 bp)
RNAseq alignments" /db_xref="GeneID:114862324" CDS 1083..1739 /gene="cldn26" /codon_start=1 /product="putative claudin-24" /protein_id="XP_029018337.1" /db_xref="GeneID:114862324" /translation="MVFLTTKMMQRTALFVTFGGLVTSLITTFLPFWKTMNSDLNEVENWFSGLWHTCLYTEEVGIQCKAYDSVLGLPMDLQISRVLMSVSIGTGGLAVLASFPGLEGVEMCSGQPGMKRRLLILGGVLSWVSGLTTLAPVSIVAYTTVVEFWDEGFPDVMPRWEYGEAMFSGWFGGLALLIGGTLLFVAVCMGDYDQRPPSVSSSPRAKHSKQHYLKTEVL" misc_feature 1119..1631 /gene="cldn26" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029162504.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-20 (LOC114848898), mRNA. (4225 bp)
alignments" /db_xref="GeneID:114848898" CDS 1014..1742 /gene="LOC114848898" /codon_start=1 /product="claudin-20" /protein_id="XP_040925206.1" /db_xref="GeneID:114848898" /translation="MASTGMQIFGFVLALLGIMGATVATLLPNWKVSADVGSNIITAISQMQGLWMDCTWYSTGMFSCTLKYSVLSLPAYLQTARTTMVLCCVLAAMGLCLASLGLKCTRWGGGRRSKRHAAIASGGCFVAAGFLCLVPASWFTNEVITSFLDASVPESNKFEPGGAVYVAFVSAGFLFVGGSIFCMSCSGKRHGPRDLVLLPPPDKLLLLLQQQQELQHQYCSLSPLDNKTGYSLQDYV" misc_feature 1023..1556 /gene="LOC114848898" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN //...
XM_041069272.1 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 15a (cldn15a), mRNA. (1891 bp)
for all annotated introns" /db_xref="GeneID:114850391" CDS 561..1229 /gene="cldn15a" /codon_start=1 /product="claudin-15a" /protein_id="XP_028998146.1" /db_xref="GeneID:114850391" /translation="MDPIVEVVALILGFTGWVMVGVALPNRYWRTSTVDGNVITTSTIYENLWMSCATDSTGVHNCREFPSLLALSGYIQASRALMITSIVLGTLGLVAALIGIQCSKAGGDNYVLKGRIAGTAGVLFVLQGLCTMIAVSWYAFNITQNFFDPLFMGTRYEIGEGLYIGWCSAVLAIAGGACLMCSCKFNTQEKYPLPYQTRGTVHSGPAPTRSMAASTYSRNAYV" misc_feature 573..1088 /gene="cldn15a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029142313.1 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin f (cldnf), mRNA. (935 bp)
by RNAseq alignments" /db_xref="GeneID:114868046" CDS 84..824 /gene="cldnf" /codon_start=1 /product="claudin f" /protein_id="XP_029027185.1" /db_xref="GeneID:114868046" /translation="MGRVGKEIAGQVLSFIGLVGVAVTAGIPMWRVTFYIGANITTGQIVWDGLWMTCVMQATGQMQCKLEMSILALTADLQAARALVIISLVFGFIGFVLTFVGAKCSSCLKSESSGAKVVILAGCLILVCAVLVLIPVCWSATVTITDYDSPLTLNTQKREIGAAIYVGWGTAAILLVAGIILATSCPPQKPVYGYPGYPPAPLYPYGANPATYAPVYAPLSNAHYSSSYAPSKQYAAPAAYAQGPYQ" misc_feature 96..626 /gene="cldnf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029171352.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114869436), mRNA. (1282 bp)
genomic feature by RNAseq alignments" /db_xref="GeneID:114869436" CDS 267..824 /gene="LOC114869436" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029029510.1" /db_xref="GeneID:114869436" /translation="MWTQVGGFVVAVIGFLGTILICALPMWIMSAFVGANIVTAQVTYQGLWMNCVIESTGVSQCQPYYSVLALPQQLQVSRALICVSIGVAALAVGFTSVGVRCNSLLSYDPRAKARYGIAGGAVFVLAGVLCLVPVSWSAYSTITGFYSSTTTSGPQGELGASIYLGWVSGALLVIGGVMLCCTYRC" misc_feature 267..803 /gene="LOC114869436" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173677.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin i (cldni), mRNA. (1114 bp)
with support for all annotated introns" /db_xref="GeneID:114860093" CDS 118..744 /gene="cldni" /codon_start=1 /product="claudin i" /protein_id="XP_029014218.1" /db_xref="GeneID:114860093" /translation="MGNVGVQIICLALGVFGLIGVIVCCIVPRWKVSSFVGSNIVTAQSTEDGLWMSCVVQSTGQQQCKTYDSILVLPSDLQAARAMVVVSCMFCCLSLLILLFGANFTTCIESESAKPKISLVAGVGLLLGGLLVIIPVSWSANTVVQNFNNPLVPQKMELGACIFVGWAAGVLLLLAGGLLCCFSRPQSGGSGGTAHFTNSTGVVNKAYA" misc_feature 130..615 /gene="cldni" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029158385.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114869882), mRNA. (1737 bp)
feature by RNAseq alignments" /db_xref="GeneID:114869882" CDS 695..1294 /gene="LOC114869882" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029030261.1" /db_xref="GeneID:114869882" /translation="MVSGTRQIAGLSLAVVGFLGTAVICALPIWCVTKTISGIVGPRMLWEGLWMHCFGLSGHKTQCRLYSGNAPRVLQAARALVVVAILFGFSAIVLVIVGGTRTSCIRTEKRKCQVHCVAGVLFIIAGLLVLIPVCWTANDIVRPQQHAYDQVHGLGAALYVGWGAAGLLVLGGGLLCTCKKNTDSNQSVRFMNLKSECED" misc_feature 713..1180 /gene="LOC114869882" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029174428.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-9 (LOC114867975), mRNA. (914 bp)
by RNAseq alignments" /db_xref="GeneID:114867975" CDS 110..778 /gene="LOC114867975" /codon_start=1 /product="claudin-9" /protein_id="XP_029027029.1" /db_xref="GeneID:114867975" /translation="MSSAGVELLGLVLAVAGWLGAMAACGLPMWRVAAYVGQNIVISQVIWEGLWMNCSVQSTGQMHCRVHDSLLGLPAALQAARALVVGSVALGAAAVGLAVAGAQCTTCKRRLAAAAGLGFAAAGLLLLAAVSWTAHAIVLDFHDPLLEETAKRDFGNALYFGWASSCLLLLGGALLCCPSPRPGGGSGRPRGDYAAAKSTSLSGHGRRDYV" misc_feature 122..622 /gene="LOC114867975" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029171196.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 1 (cldn1), mRNA. (1497 bp)
support for all annotated introns" /db_xref="GeneID:114844873" CDS 135..770 /gene="cldn1" /codon_start=1 /product="claudin-1" /protein_id="XP_028988368.1" /db_xref="GeneID:114844873" /translation="MANKGIELLGFSLAFLGFVGCIASTIMVQWKASSYAGDNIITAQAMYEGLWQSCASQSTGQIQCKFYDSLLQLPGMVQTTRGLMLASILLSTIAVLVETVGMKCTTCMADQPEMKSKVALAGGVVFIIAGLLALVGASWYANRVAQDFYNPLTPTNSRYEFGSALYVGWGAAALTVIGGSFLCCSCPQKSAASAPRYPQARSAAQPGGNYV" misc_feature 144..680 /gene="cldn1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029132535.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114869435), mRNA. (2026 bp)
all annotated introns" /db_xref="GeneID:114869435" CDS 1106..1723 /gene="LOC114869435" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029029509.1" /db_xref="GeneID:114869435" /translation="MPSLLVLSRLQILGAVLGSIGWMGTIISCGYPMWTVGVFLGCSPTPSRPYWEGLWMSCEVESTGQKQCKVYRSLLALTDQMQAARAMVVVSVVAGAVAVLMAAIGGKCPCLEDKVVKAKVSIASGVTFIASALLIIIPVSWIACSALTTPMRLGSVKRDLGTSLYIGWASGALLLLGGSLICLRCLPNHERPYKFITFTSSASDV" misc_feature 1133..1609 /gene="LOC114869435" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173676.1 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114868050), mRNA. (1049 bp)
by RNAseq alignments" /db_xref="GeneID:114868050" CDS 140..763 /gene="LOC114868050" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029027190.1" /db_xref="GeneID:114868050" /translation="MVSAGFQMLGTALCIIGWIAAIITCALPQWRVTAFIGNNIVTAQTTWVGIWMECVVQSTGQMQCKMYDSMLALSQDLQAARALMIISILLGVLGVLLAVAGGKCTNCVEDEGAKAKVGVASGVTFILAGVLCLVPVCWTANAVVRDFYNPMLGSSQKMELGTSLFIGWGGAALLILGGGLLCANCPPRDNYPAKYTGNRATAPKGYV" misc_feature 152..643 /gene="LOC114868050" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029171357.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114869434), mRNA. (1389 bp)
by RNAseq alignments" /db_xref="GeneID:114869434" CDS 503..1120 /gene="LOC114869434" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029029508.1" /db_xref="GeneID:114869434" /translation="MPSQGVQMLGAMLGAIGWLGTIISCLLPTWRVTAFIDSNIVTAIVTWEGLWMSCVVQSTGQRQCKVYSSMLALPQHLQAARAMVVVSVVAGAFGVLVATIGGKCTNCLEDKVVKAKVSIASGVTFIASALLIIIPVSWTAHSVIRDFYNPLMLDSLKRELGASLFIGWVSGALLLLGGSLLCWSCPPNHDRPYMTSRFASSMSYV" misc_feature 515..1009 /gene="LOC114869434" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173675.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114869433), mRNA. (1518 bp)
by RNAseq alignments" /db_xref="GeneID:114869433" CDS 585..1211 /gene="LOC114869433" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029029507.1" /db_xref="GeneID:114869433" /translation="MTSLLVLSRLQILGAVLGSIGWMGTIISCGYPMWTVIFFLGCGIISHSPIWEGLWMSCVVQRTGQKQCKVYSSMLELPQHLQAARAMVVVSVVTGAVAVLMVAIGGKCPCLEDKVVKAKVSIASGVTFIASALLIIIPVSWTAHSVIRDFYDPLVLNSLSREFGASLYIGWASGALLLLGGSLLCLRCLPNHERPYKFTTFTSSASDV" misc_feature 612..1097 /gene="LOC114869433" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173674.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114869432), mRNA. (1303 bp)
by RNAseq alignments" /db_xref="GeneID:114869432" CDS 496..1122 /gene="LOC114869432" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029029506.1" /db_xref="GeneID:114869432" /translation="MPSLLVLSRLHILGAVLGSIGWMGTIISCGYPMWTVSVFLGCGIICYSPIWDGLWMRCEVESTGQKHCKVYSSMLELPQHLQVARAMVVVSVVTGAVAVLMVAIGGKCPCLEDKVVKAKVSIASGVTFIASALLIIIPVSWTAHSVIRDFYDPLVVNSLKREFGASLYIGWASGALLLLGGSLLCLRCLPNHERPYKFITFTSSASDV" misc_feature 523..1008 /gene="LOC114869432" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173673.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114869424), mRNA. (1066 bp)
by RNAseq alignments" /db_xref="GeneID:114869424" CDS 94..735 /gene="LOC114869424" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029029498.1" /db_xref="GeneID:114869424" /translation="MVSAGLQMLGASLGILGWIGVIVTCALPMWKVTAFIGSNIVTSQTSWEGIWMSCVVQSTGQMQCKVYDSMLALSTDLQAARALTIVSILVGVMGILLSVAGGKCTNCVENETSKTKVGITAGVMLIIAGVLCAVPVCWTANTIIQDFYNPLVYSGQKRELGAALFIGWGSAALLLIGGGLLCCNCPPKDKTPYTAKYNAARSDASGPPGKSMV" misc_feature 106..609 /gene="LOC114869424" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173665.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-3-like (LOC114867976), mRNA. (1133 bp)
by RNAseq alignments" /db_xref="GeneID:114867976" CDS 64..711 /gene="LOC114867976" /codon_start=1 /product="claudin-3-like" /protein_id="XP_029027030.1" /db_xref="GeneID:114867976" /translation="MSLGLELIGISLCILGWIIATVACALPMWRVTAFIGSNIVTAQIIWEGLWMTCVVQSTGQMQCKVYDSMLALSQDLQAARALTVISILLAIMAVLVAVAGAKCTNCIEDEASKAKVMIISGVFFMVSGVMQLIPVSWSANTIIRDFYNPTLNDAQRRELGAALYIGWGAAALLLLGGGLLCCSCPPPESRYGATRMAYSASRSAGGPGLERKDYV" misc_feature 73..564 /gene="LOC114867976" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029171197.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 7a (cldn7a), mRNA. (1720 bp)
support for all annotated introns" /db_xref="GeneID:114844556" CDS 177..818 /gene="cldn7a" /codon_start=1 /product="claudin-7-A" /protein_id="XP_028987862.1" /db_xref="GeneID:114844556" /translation="MANSGIQLLGFFLSLIGIVGLIIGTILPQWKMSAYIGDNIITAVAMYQGLWMSCAFQSTGQLQCKIYDSILQLDSALQATRALMIVGIIVSIAGLGVACMGMKCTTCGGNDKLRKSRIALTGGIILLVGGLCAIVACSWFAHNVIRAFYNPYTPVNTKFEFGAAIFIAWGGSLLDVLGGAMLAASCPGRKQVSKYPSMAGSRSGPPSSTKEYV" misc_feature 186..722 /gene="cldn7a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029132029.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114868047), mRNA. (1374 bp)
by RNAseq alignments" /db_xref="GeneID:114868047" CDS 75..728 /gene="LOC114868047" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029027186.1" /db_xref="GeneID:114868047" /translation="MTCVLPLRAADSGLRMLHTLGAAMALSGWLLVVAACCLPAWKVAAVGAARPGWTGLWASCVEQSGGRMRCQRLDSVLALPRDLQAARGLTLLSLVTGLCGAGVSVLGGRCVRCVENERSRAQARVLAGSFFAVSGCLCLVSVSWSAYATVAGAGADPLTAEARSYALGAALFMGWAAAALLLAGGGLLCVKCPPRREHAAGVVTFTPVSSTTSKEGV" misc_feature 132..599 /gene="LOC114868047" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029171353.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-3-like (LOC114869437), mRNA. (1978 bp)
by RNAseq alignments" /db_xref="GeneID:114869437" CDS 115..762 /gene="LOC114869437" /codon_start=1 /product="claudin-3-like" /protein_id="XP_029029511.1" /db_xref="GeneID:114869437" /translation="MSMGMEIVGIALGCIGFIIAIVTCALPMWKVTAFIGANIVTAQTIWEGLWMNCVIQSTGQMQCKIYDSMLALNPDLQAARAMTVVAIILALLGVLISIVGAKCTNCIEDEASKAKVMIIAGIFFLLAGLLVLIPVSWTSSVIIRDFYNPLLTDAQRREIGASLYIGFGAAVLLIIGGAMLCSSCPPKEKQYKPPRMMYSAPRSASGAGYDKKDYV" misc_feature 121..654 /gene="LOC114869437" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173678.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4 (LOC114866224), mRNA. (3164 bp)
alignments" /db_xref="GeneID:114866224" CDS 2155..2844 /gene="LOC114866224" /codon_start=1 /product="claudin-4" /protein_id="XP_029023781.1" /db_xref="GeneID:114866224" /translation="MVNTGMQLISFTCAVTGWIMAIAVTALPQWKVSAFIDGAILTWEIRWEGIWMNCVYQTTGHMQCKTYDSMLALPPDIQAARALMCLAIFMGWLSCTVSCCGMKCTTCAGDDRRAKAGIALFGGILFILTGLCVLIPVSWTANTIIQDFYNPKVPTMHKRELGQAIYLGWASAVILMLSGAVLSSTCPLMERNGRYRRGYIGRSFANSPVLVPDPPKPITTSSLPMKEYV" misc_feature 2164..2700 /gene="LOC114866224" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029167948.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-4-like (LOC114868030), mRNA. (1096 bp)
RNAseq alignments" /db_xref="GeneID:114868030" CDS 191..865 /gene="LOC114868030" /codon_start=1 /product="claudin-4-like" /protein_id="XP_029027151.1" /db_xref="GeneID:114868030" /translation="MERQLELAALAVALCGWFCAILTRCLALWTVSGTLNNLTATLPAYWDGVWLEWDHWDLAHDGSLHCSFYQLLMSLSGSFRTWRALIMAAIGAGSFAVVIGAVGAVWFPARGQVKVFAGALFALSGILLLVPTAWTCHHTTQPLEGTVLLRRAWGPALYLGWISFALMLAGGVFLMTRCHSGSTKPQQPQVGAYPTQEDQSNHPLSRINRTTFTHSQYERRSEPI" misc_feature <371..712 /gene="LOC114868030" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029171318.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-17-like (LOC114868736), mRNA. (1038 bp)
RNAseq alignments" /db_xref="GeneID:114868736" CDS 73..747 /gene="LOC114868736" /codon_start=1 /product="claudin-17-like" /protein_id="XP_029028394.1" /db_xref="GeneID:114868736" /translation="MKRKLEVLILVLGVIGLIGTIAATAMPMWRVSAFIGANLIVMETLWEGLWMDCYYEVIRMQCKVYDSMLILPPELQASRALMSAAVALAVVSVVVTATGLSKGRLGSDDVRARRITLAFGGVLFLLSSVSTLIPVSWVGYTVIADFYNPTVIDARKRELGSALFVGWATSAILLVTGILLLASCSKSREEEPYAGVHLMPLKDEGKEESASRAPSSFHKHQEYV" misc_feature 85..612 /gene="LOC114868736" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029172561.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 11b (cldn11b), mRNA. (1076 bp)
for all annotated introns" /db_xref="GeneID:114852925" CDS 256..906 /gene="cldn11b" /codon_start=1 /product="claudin-11b" /protein_id="XP_029001480.1" /db_xref="GeneID:114852925" /translation="MAHICRQMTGSTASCAGWIGIIVATATNDWVRTCEHSMATCLRMDELGSRGLWAECVISPTLYHCVTLNQILNLPAHIQTARALMILACLMGLPGMMLLLTSMPCVRLPNDSSAIKKLRARAGSVLFILMAVCGAISTVWFPIGAHHNEGLMSFGFSLYAGWVGSGLCLLGGTMMLCFHSTVPWSPSRDNSFYYSRQRGTATAVDPPANHGKSERV" misc_feature 274..777 /gene="cldn11b" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029145647.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens putative claudin-24 (LOC114853731), mRNA. (1195 bp)
alignments" /db_xref="GeneID:114853731" CDS 168..815 /gene="LOC114853731" /codon_start=1 /product="putative claudin-24" /protein_id="XP_029003287.1" /db_xref="GeneID:114853731" /translation="MDACACALELLGMLVYVGAWLCALATTILPQWLTMSTALLPTESYELGLWETCVVQDVGGMECRPYDSLLGLSRDLQLARILMCACLAVGVLGILVAVPGLYLVNSCKNRTKRTFMVAGGVLGMISGVLCLIPVCYMAHLAIMHFFDETVPDVVPRWEFGDALFCGWAGGFLLIAAGLLLVSSSVCLQVEPQPLGQRRYQVMNTDCNPRKHSEYV" misc_feature 186..707 /gene="LOC114853731" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029147454.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-3-like (LOC114869427), mRNA. (4361 bp)
alignments" /db_xref="GeneID:114869427" CDS 3122..3793 /gene="LOC114869427" /codon_start=1 /product="claudin-3-like" /protein_id="XP_029029500.1" /db_xref="GeneID:114869427" /translation="MVAFGLELVGVSLSVLGWALSVVSCALPMWRVSAFIGANIVTAQVYWEGLWMSCVFQSTGQMQCKVYDSMLALPQDLQAARALTIVSIVIGVLALLISLVGAQCTNCIEDKGAKARVMASSGGGFIAAAVAQLVPVSWSANTIVTEFYSPIVPNGQKMEIGAALYLGWAAAALLLTGGCILCCSCPPKEEKPLRYTVNPQTRMAYSAAPMSTAQSSYNRKDYV" misc_feature 3134..3589 /gene="LOC114869427" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173667.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 11a (cldn11a), mRNA. (3618 bp)
for all annotated introns" /db_xref="GeneID:114848306" CDS 1971..2621 /gene="cldn11a" /codon_start=1 /product="claudin-11a" /protein_id="XP_028994534.1" /db_xref="GeneID:114848306" /translation="MANSCLQLSGFLLSCLGWLGIVIATATNDWVNMCKYGLNTCKKMDELGAKGPWADCVISTGLYHCVSLTQILDLPAYIQTTRALMITASILGLPAAGMLLMSMPCISLGSEPQSSRNKRTILGGVIIVIVALCGMVSTVWFPIGAHQEHGLMSFGFSLYTGWVGTIFCLLGGSILACCSAEPSSYQDSGRFYYSKQGGGAQPSAASAVTHAKSAHV" misc_feature 1986..2495 /gene="cldn11a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029138701.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 18 (cldn18), mRNA. (959 bp)
all annotated introns" /db_xref="GeneID:114844900" CDS 45..767 /gene="cldn18" /codon_start=1 /product="claudin-18" /protein_id="XP_028988410.1" /db_xref="GeneID:114844900" /translation="MAPSVLQNGGFILGLIGAAALVAATAMNNWSVKDRQGDVVTSVYTYKGLWQDCETTSSGFNECRPLYGLLGYTGTFQAVRALMIVGVVLSVLGAVISVFSLKCLTMNTMEDRTKAKMSLTAGIMFIIAGLCGIAGASIYANQIVSSFTMSTYNNNYGGGMMGMGGGMQGIPTYTFGPALFVAWIGGGVLVIGGILKSLAFKEMVKDEKLQYPGVVYKPQSRSKSEPGEHQPEGDKKNHYV" misc_feature 60..593 /gene="cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029132577.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-like protein ZF-A89 (LOC114869429), mRNA. (728 bp)
by RNAseq alignments" /db_xref="GeneID:114869429" CDS 1..633 /gene="LOC114869429" /codon_start=1 /product="claudin-like protein ZF-A89" /protein_id="XP_029029503.1" /db_xref="GeneID:114869429" /translation="MASTGLHVFGVLLACVGFLGDIVICALPMWKVSAFIGNNIVTAQVFWEGLWMNCVMQSTGQMQCKVYDSMLALPQDLQAARALVVVSILVVLFGLLLSVAGGKCTTCIEDEASKNKVAVVAGAVFIVGGLLVLVPVCWSANAVIRDFYNPGVADAQRRELGASLFIGWASAGLLLIGGALLCCQCPQSKDTRYTAKYSAPRSAAGAGAYV" misc_feature 10..510 /gene="LOC114869429" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173670.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-like protein ZF-A89 (LOC114869438), mRNA. (789 bp)
RNAseq alignments" /db_xref="GeneID:114869438" CDS 36..668 /gene="LOC114869438" /codon_start=1 /product="claudin-like protein ZF-A89" /protein_id="XP_029029512.1" /db_xref="GeneID:114869438" /translation="MASTGLHVFGVLLACVGFLGDIVICALPMWKVSAFIGNNIVTAQVFWEGLWMNCVMQSTGQMQCKVYDSMLALPQDLQAARALVVVSILVVLFGLLLSVAGGKCTTCIEDEASKNKVAVVAGAVFIVGGLLVLVPVCWSANAVIRDFYNPGVADAQRRELGASLFIGWASAGLLLIGGALLCCQCPQSKDTRYTAKYSAPRSAAGAGAYV" misc_feature 45..545 /gene="LOC114869438" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173679.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin-like protein ZF-A89 (LOC114869430), mRNA. (796 bp)
RNAseq alignments" /db_xref="GeneID:114869430" CDS 45..677 /gene="LOC114869430" /codon_start=1 /product="claudin-like protein ZF-A89" /protein_id="XP_029029504.1" /db_xref="GeneID:114869430" /translation="MASTGLHVFGVLLACVGFLGDIVICALPMWKVSAFIGNNIVTAQVFWEGLWMNCVMQSTGQMQCKVYDSMLALPQDLQAARALVVVSILVVLFGLLLSVAGGKCTTCIEDEASKNKVAVVAGAVFIVGGLLVLVPVCWSANAVIRDFYSQIVATAQKRELGAALFIGWASAGFLLIGGALLCIRCPQHKDTRYTAKYSAPRSAAHASTNP" misc_feature 54..587 /gene="LOC114869430" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029173671.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Microtus oregoni claudin 1 (Cldn1), mRNA. (3214 bp)
support for all annotated introns" /db_xref="GeneID:121464945" CDS 184..819 /gene="Cldn1" /codon_start=1 /product="claudin-1" /protein_id="XP_041533999.1" /db_xref="GeneID:121464945" /translation="MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTVGMKCMKCLEDDEVQKMWMAVIGGVIFLVSGLATLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV" misc_feature 196..729 /gene="Cldn1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /db_xref="CDD:395662" ORIGIN //...
XM_041678065.1 - Microtus oregoni (creeping vole) - NCBI
PREDICTED: Aquila chrysaetos chrysaetos claudin 20 (CLDN20), mRNA. (3421 bp)
for all annotated introns" /db_xref="GeneID:115344658" CDS 258..917 /gene="CLDN20" /codon_start=1 /product="claudin-20" /protein_id="XP_029878224.1" /db_xref="GeneID:115344658" /translation="MASASLQFFAFILALFGVFGDITATLLPNWKVNADVGSNIITAITQMQGLWMDCTWYSTGMFSCTLKYSVLSLPVYIQAARTTMVLSCILSAFGICITTVGMKCTKLGGDPDSKSHACFAGGVCFILAGIFGLVPTSWYTREIISNFLDQTIPESSKHEPGGAVYIGFISAAFLLIAGVIFCTSCFKKQQGAWIYGPKQHHFPSTEQESNAGYNLKDYV" misc_feature 270..800 /gene="CLDN20" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833" ORIGIN //...
XM_030022364.1 - Aquila chrysaetos chrysaetos - NCBI
PREDICTED: Betta splendens claudin-10-like (LOC114847292), mRNA. (1404 bp)
alignments" /db_xref="GeneID:114847292" CDS 55..780 /gene="LOC114847292" /codon_start=1 /product="claudin-10-like" /protein_id="XP_028992686.1" /db_xref="GeneID:114847292" /translation="MSSMFQEILAFILTVSGWVLVCSTLPTDYWQVSSNDGSVITTSNFWSNLWKACVTDSTGLSNCRDFPSMLALEGYIQACRGLMIAAVCLGFFGSIFALIGMKCTKIGGTDKNKARIACFAGVNFILCGLCSLSACSLYAHRITTEFFDPMFYDQKYELGAALFIGWGGSVLCILGGGMFCFSIADSFSKSHSRGNYKYKGAARHSHISSYPRGQAVSVNHRPPPDNSNSSRVQHFDKNVYV" misc_feature 64..591 /gene="LOC114847292" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029136853.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 23.1 (cldn23.1), mRNA. (1753 bp)
db_xref="GeneID:114866424" CDS 193..1020 /gene="cldn23.1" /codon_start=1 /product="claudin 23a" /protein_id="XP_029023984.1" /db_xref="GeneID:114866424" /translation="MPGRSSQEWVRLSLRTPGILIFGMVLAPCGWILDLTATVAPNWRTLSNLANSPPSQYLEQGVWDICLADTTTTSPTCGQTNNTYLSNTYVKVGQGCSVASLILTIVGLIVAVPGVRCWRDRPNWVVAGLGGILIFCSGVLMIAAVGVYTFWLIDRRADNPSGTLAAGYSIYLGFIGGILEVLGGFVMAIGICRCCGGKNRGEKRVEEVRAQFNQPRPQPKPQYAPRSTRPASSISSSVPYSRDELDDDVSFPRAKSPAARSANTPRGARPYDADL" misc_feature 244..744 /gene="cldn23.1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029168151.2 - Betta splendens (Siamese fighting fish) - NCBI
PREDICTED: Betta splendens claudin 15-like a (cldn15la), mRNA. (866 bp)
for all annotated introns" /db_xref="GeneID:114844213" CDS 186..839 /gene="cldn15la" /codon_start=1 /product="claudin 15-like a" /protein_id="XP_028987235.1" /db_xref="GeneID:114844213" /translation="MSAAMETTGFVMAIISWLVTGTALANDHWKISTVSGNVITSQRITENLWHSCAENSASMVQCRDFESLLDLPSHIAGCRALMIISLLLGFASIIVSLLGLKCITVGSASDQSKAKMALGGGIVSILAGLCCLVACSWYAYRVVQDFYSPQYLGMKFELGAGLYLGWAAATLAILGGGFLCSAVSRTKSNASAAAYYGKAPQKIYTAKTETETAKSFV" misc_feature 210..722 /gene="cldn15la" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:354884" ORIGIN //...
XM_029131402.2 - Betta splendens (Siamese fighting fish) - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/claudin
lang : ja | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.101 | 0.101 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.175 | 0.074 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.181 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]