2024-05-05 19:05:08, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001277769 741 bp mRNA linear VRT 24-SEP-2023 DEFINITION Gallus gallus claudin 10 (CLDN10), transcript variant 3, mRNA. ACCESSION NM_001277769 VERSION NM_001277769.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 741) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 741) AUTHORS Collins MM, Baumholtz AI, Simard A, Gregory M, Cyr DG and Ryan AK. TITLE Claudin-10 is required for relay of left-right patterning cues from Hensen's node to the lateral plate mesoderm JOURNAL Dev Biol 401 (2), 236-248 (2015) PUBMED 25744724 REMARK GeneRIF: The data demonstrate a novel role for Claudin-10 during the transmission of laterality information from Hensen's node to both the left and right sides of the embryo. [claudin-10] REFERENCE 3 (bases 1 to 741) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 741) AUTHORS Seo HW, Rengaraj D, Choi JW, Ahn SE, Song YS, Song G and Han JY. TITLE Claudin 10 is a glandular epithelial marker in the chicken model as human epithelial ovarian cancer JOURNAL Int J Gynecol Cancer 20 (9), 1465-1473 (2010) PUBMED 21370593 REMARK GeneRIF: New insight into using the chicken as a suitable animal model for investigating the effect and function of CLDN in human ovarian cancer. REFERENCE 5 (bases 1 to 741) AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, Burnside J, Aggrey SE, Simon J and Cogburn LA. TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs from single and multiple tissue cDNA libraries and CAP3 assembly of a chicken gene index JOURNAL Physiol Genomics 25 (3), 514-524 (2006) PUBMED 16554550 REFERENCE 6 (bases 1 to 741) AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. TITLE A comprehensive collection of chicken cDNAs JOURNAL Curr Biol 12 (22), 1965-1969 (2002) PUBMED 12445392 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CV038199.1 and BX936162.2. On Nov 24, 2021 this sequence version replaced NM_001277769.1. Transcript Variant: This variant (3) has an alternate first exon in place of the first exon of variant 1. The resulting isoform (3) has a shorter and distinct N-terminus compared to isoform 1. ##Evidence-Data-START## Transcript exon combination :: BU287383.1, ERR2365562.59808.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992428, SAMEA103992559 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-200 CV038199.1 1-200 201-741 BX936162.2 244-784 FEATURES Location/Qualifiers source 1..741 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="1" /map="1" /breed="Leghorn" gene 1..741 /gene="CLDN10" /gene_synonym="claudin-10" /note="claudin 10" /db_xref="CGNC:13756" /db_xref="GeneID:418790" exon 1..192 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" CDS 123..659 /gene="CLDN10" /gene_synonym="claudin-10" /note="isoform 3 is encoded by transcript variant 3" /codon_start=1 /product="claudin-10 isoform 3" /protein_id="NP_001264698.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="
MNCAGNALGAFHCRPHLTIFKVEGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV"
misc_feature <180..509 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" exon 193..354 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" exon 355..436 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" exon 437..544 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" exon 545..741 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" ORIGIN
cttttatattttctttttgtgggttagcagccacgattgctgctactgcatcgaatgagtggaaagtcacaagccgagcatcatctgttatcaccgcaacctgggttttccagggtctgtggatgaactgtgcgggcaacgcgctgggtgcttttcactgcagacctcaccttactatcttcaaagtggaaggttacatccaagcctgcagaggactaatgatctccgctgtctgtctgggtttctttggctccgtttttggactggttgggatgaagtgcacaaaaatcggcggatctgatcaaaataaagcaagaatagcttgtttagctggactgattttcatactgtgtgggctgtgctccatgactggttgttccctgtatgcacacaggattacgtctgagttctttgatccttcttttgttgcacaaaagtatgaattaggagcagctttattcattggatgggctggagcttcactctgcatcattggtggcagtatattctgcttctcaatagctgagaacagtaaatctccaaggagagcgtatgcatataatggagccgcatctgtgatgtcgtctcgtacaaagattcacaacagtgtcccagacaaaacctcaccaaagcactttgacaagaacgcttacgtttaagtgtacttttctaagatctgaagccagttttaaaaatgagtttgtatgtttcattcagggtgatttccccccccacctcccc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]