GGRNA ver.2 Help | Advanced search | English    旧バージョン

2024-02-26 13:35:51, GGRNA : RefSeq release 221 (Nov, 2023)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Caenorhabditis elegans Protein clarinet (cla-1), partial mRNA. (25584 bp)
tccacggaaaatgaaattaccaatacgagtaatcaaacagcaaacatagtaattgatccaggaagtattgattcagaagaaataaacaaattagccgcaaaattagttgaagaatcaattctcaaagcatcacaggaagcagcatcagataaccacgagaaagaaagatcaagtgcaacatcaaaagctgattatgaaagatcatttgatcaagacgtcacttatgaaagatcttcaccgttgcttgaaccaagtgaagaaccagtgatggaatccaaagaaccagaactgacacaagaagagattgatcacattgcaaggatccagagtcttgcagaacaatcatcattcgaacaagcttcaacgattcctgatcgaccacctcttccagcccggcttccgactgtagacgagccgattgtcatctcagaacaacacgaagaagacagatcaagtgcaacatcgggagctgactatgaaagatccttcgatcaagaagtcacgtatgaaagatcttcaccgttgcttgaaccatgtgaagaaccagtgatggaatccaaagaaccagaactgacacaagaagagattgatcatattgca...
position 1741
NM_001307220.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Protein clarinet (cla-1), partial mRNA. (27002 bp)
tccacggaaaatgaaattaccaatacgagtaatcaaacagcaaacatagtaattgatccaggaagtattgattcagaagaaataaacaaattagccgcaaaattagttgaagaatcaattctcaaagcatcacaggaagcagcatcagataaccacgagaaagaaagatcaagtgcaacatcaaaagctgattatgaaagatcatttgatcaagacgtcacttatgaaagatcttcaccgttgcttgaaccaagtgaagaaccagtgatggaatccaaagaaccagaactgacacaagaagagattgatcacattgcaaggatccagagtcttgcagaacaatcatcattcgaacaagcttcaacgattcctgatcgaccacctcttccagcccggcttccgactgtagacgagccgattgtcatctcagaacaacacgaagaagacagatcaagtgcaacatcgggagctgactatgaaagatccttcgatcaagaagtcacgtatgaaagatcttcaccgttgcttgaaccatgtgaagaaccagtgatggaatccaaagaaccagaactgacacaagaagagattgatcatattgca...
position 1741
NM_001307219.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Pantherophis guttatus uncharacterized LOC132711909 (LOC132711909), ncRNA. (112 bp)
using gene prediction method: Gnomon." /db_xref="GeneID:132711909" ncRNA 1..112 /ncRNA_class="lncRNA" /gene="LOC132711909" /product="uncharacterized LOC132711909" /db_xref="GeneID:132711909" ORIGIN // caactctaatggctctccagtacacatctggaactgctggatggcctcgtggtgagacctcttatacccagggggaggagtcagaggcaagaagagattgcaccaatgaggg
position 88
XR_009622629.1 - Pantherophis guttatus - NCBI
PREDICTED: Pseudonaja textilis uncharacterized LOC113437314 (LOC113437314), ncRNA. (153 bp)
including 1 sample with support for all annotated introns" /db_xref="GeneID:113437314" ncRNA 1..153 /ncRNA_class="lncRNA" /gene="LOC113437314" /product="uncharacterized LOC113437314" /db_xref="GeneID:113437314" ORIGIN // acaatcatccaatggaacagcttgccatcagaagctgtgagtacttcatcacttgagactttcaagaagagattggactgtcatttttcagaaatggtgtaggtctcctgcttgggcaggggtttggactagattacctacaaggtcttttcc
position 63
XR_003374214.1 - Pseudonaja textilis - NCBI
Caenorhabditis elegans Unclassified non-coding RNA ZK1193.9 (ZK1193.9), ncRNA. (133 bp)
AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA gaaggcgaccacgtcgtcgccaagaagagattgaagacgacgaatggagcgaaagtagtaaggaggggttgagggggggggaggtcgggatcgagatggcataatgtaggaaccggatggaagagtctaaaag
position 21
NR_070329.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Helianthus annuus uncharacterized LOC110938512 (LOC110938512), ncRNA. (219 bp)
ncRNA 1..219 /ncRNA_class="lncRNA" /gene="LOC110938512" /product="uncharacterized LOC110938512" /db_xref="GeneID:110938512" ORIGIN // ctcaagtacggcgtgcaacaagtgcctacccacgtcgtcaaagaactcatcatgcacgaggtggtgcttgggggtggccaggatgcatctgctgttaccacaaccatcatcgtgcggggaagtttgaagccaaattttatgacaaggttctgcaagaagagattggaggcgttaaaggacatttcgggccaattaatgctttggcattcaacccggatg
position 153
XR_002591448.2 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Gossypium hirsutum calcium load-activated calcium channel (LOC107891247), mRNA. (1188 bp)
misc_feature 420..899 /gene="LOC107891247" /note="Integral membrane protein DUF106; Region: DUF106; pfam01956" /db_xref="CDD:396507" ORIGIN // gggattataggaggtgtgtttttctgggaacatatctttggagttgaatgctaacaagaagagattgaagttagtctatttaagttgaatgctaacaagaagagattgaagttagtctatttaagtgaatgcttcaagttgaactccgcaaattgtgaaagaaagaggtttcttgagttcatccttttcatttgtaggttgtatcgtttaataatagagataagagatgggttgaaatgagtaagcccatagtggtgagaaataaaaggcaaagcccactccttgggttgtcgtctacttgggattcgaatcaatttgactaggaacggatcacagagactgagagtgaagacacccacccaatcaaccttgtgaaaatggcgacaccccaattcctatcatccttccagtactccgacagtctaacagtcgtagctatctccttttgcactgccat...
position 55
XM_016815976.2 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Dioscorea cayenensis subsp. rotundata uncharacterized LOC120275457 (LOC120275457), ncRNA. (148 bp)
samples with support for all annotated introns" /db_xref="GeneID:120275457" ncRNA 1..148 /ncRNA_class="lncRNA" /gene="LOC120275457" /product="uncharacterized LOC120275457" /db_xref="GeneID:120275457" ORIGIN // tgaaacccaaatcatgttttatgtttatggttgtagtaatgttcttcgtcatgtataagttgacaaaattccaacaggcacaagaagagattgaatcagtatctcagacttttgattccatgatgaggaggacaccaaagaagctgta
position 81
XR_005541109.1 - Dioscorea cayenensis subsp. rotundata (Guinea yam) - NCBI
PREDICTED: Trematomus bernacchii all-trans-retinol 13,14-reductase-like (LOC117496684), mRNA. (1486 bp)
gtccgggccatagagatcaaatgtgtctgtacgctgctcaatatcctcttcattggtctatttcatatcatttcaggtgtccctcctaaagagtccagctttctgatcaatgctctccttcttcaacactacaagcgtggtgcctactactcacaggggggcgccagtgagtttgccttccacatcatcaatgtcattgagaaggcgggcggtgctgttctcgtcagggctccggtacaccgcgtcctgctcaaccggcagaacaaggcctatggtgtgacggtgctcaaaggacaagaagagattgaggtccatgcccctgttgtcatttctaatgctggcattttcaacatattcgagaagtttctacctcagcccatacaggagaaaccaggtgtccctcctaaagagtccagctttctgatcaatgctctccttcttcaacactacaagcgtggtgcgtactactcacggggggcgccagtgtgtttgccttccacatcatcaatgtcattgagaaggcgggcggtgctgttctcgtcagggctccggtacaccgcgtcctgctcaaccggcagaacaaggcctatggtgggaaaa...
position 370
XM_034148409.1 - Trematomus bernacchii (emerald rockcod) - NCBI
Polysphondylium pallidum PN500 40S ribosomal protein S30 (rps30-2), partial mRNA. (198 bp)
G., Schaap,P., Noegel,A.A., Felder,M. and Platzer,M. TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Genome Analysis, Fritz Lipmann Institute, Beutenbergstr. 11, Jena 07745, Germany atgggtaaggttcacggtggtttgaacagagctggtaaagtcagaaacgctactccaaacgttgagaagaaggaggtcagaaagccaaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcgttggtttcggaaagaagaagggttacaacactcaaaacgtcccaaatgtctaa
position 102
XM_020573799.1 - Heterostelium album PN500 - NCBI
PREDICTED: Cricetulus griseus uncharacterized LOC103163642 (LOC103163642), ncRNA. (277 bp)
product="uncharacterized LOC103163642" /db_xref="GeneID:103163642" ORIGIN // tatagactgctgcatgctggctggctaggttgctctttttaacttagaaagttgaggaaacaacaaagtagaggatgaatggtatctggaggttgacatactgatactcggggaaggtacagatgtgaatttcagcatgaagaaaggaagatattttctgttgttcaaggatgagacataccatatgagagggagccactataggtccaagaagagattgggaccatggagatttccagagacctacaaggatgacatgatctcataatcaaggcaa
position 208
XR_003480888.2 - Cricetulus griseus (Chinese hamster) - NCBI
Rhizoctonia solani ribosomal protein S30 (RhiXN_09607), partial mRNA. (192 bp)
AUTHORS Li,C. and Chen,X. TITLE Direct Submission JOURNAL Submitted (18-MAY-2020) Department of Plant Pathology, China Agricultural University, Yuanmingyuan Xilu 2, Beijing 100193, China atgggaaaagtccacggctcgctcgcccgcgcaggcaaagtcaaatctcaaactcccaaagtggagaaacaggagaagaagaagactcctaaaggtcgtgccaagaagagattgttgtacactcgtcgtttcgtgaatgttacgacgcttccaggcggaaagaggcgcatgaaccccaaccccgagaagtaa
position 102
XM_043329423.1 - Rhizoctonia solani - NCBI
Diutina rugosa uncharacterized protein (DIURU_003940), partial mRNA. (300 bp)
for Genomic Regulation, Carrer Dr. Aiguader, 88, 5, Barcelona 08003, Spain atggctaagtctggtattgctgttggtctcaacaagggtcacaagactaccgctaaggaagtcgcccccaagatctcgtacagaaagggtgccctcaccaagagaaccgagttcgtcagatcgatcgtgtcggaagtcgccgggttggctccttacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagagatgaacggtgtcatcgctgcttccagaaagcactaa
position 216
XM_034156758.1 - Diutina rugosa - NCBI
Saccharomyces paradoxus Gyp5 (SPAR_P00270), partial mRNA. (303 bp)
and Aging, Nice (IRCAN), 28 Avenue de Valombrose, Nice, PACA 06107, France atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagctccaaagatctcctacaagaagggtgctgcctctaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
position 219
XM_033913633.1 - Saccharomyces paradoxus - NCBI
PREDICTED: Physeter catodon non-histone chromosomal protein HMG-14-like (LOC102973125), mRNA. (255 bp)
codon_start=1 /product="non-histone chromosomal protein HMG-14-like" /protein_id="XP_054936220.1" /db_xref="GeneID:102973125" /translation="MPKKKVSSAEGAVKEEPKKRLARLSAKPAPAKVETKPKKAAGKDTSSDKKCKPKGKGGAKAKQAEMANQATKEDLPAENGETKN" ORIGIN // atgcccaagaagaaggtcagctccgctgagggggcagtgaaggaggagcccaagaagagattggcaaggttgtcagctaaaccggctcctgcaaaagtggaaacgaagccaaaaaaggcagcaggaaaggatacatcttcagacaaaaagtgcaaaccaaagggaaaagggggagcaaaggcaaaacaggctgaaatggctaaccaagcgactaaagaagacttacctgcagaaaatggagaaactaaaaactag
position 51
XM_055080245.1 - Physeter catodon (sperm whale) - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (297 bp)
Acytostelium Genome Consortium TITLE Direct Submission JOURNAL Submitted (05-SEP-2014) Contact:Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan ggtcagaaacgctactccaaacgtggagaagaaggagacccgcaagtccaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcaccggtttcggaaagaagaagggatacaacacccagaacgttccaaatgtctaagcaacatagtagcgtcgcgtccgtccctcagtagtcccgtgcctctccgctcattgcaacactggacactcgatcacggaggccagtcggtcctcaacagcccgtctgtcctccacgtaaataaacaaccggctttc
position 64
XM_012897535.1 - Acytostelium subglobosum LB1 - NCBI
PREDICTED: Fukomys damarensis uncharacterized LOC117283624 (LOC117283624), ncRNA. (322 bp)
by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:117283624" ncRNA 1..322 /ncRNA_class="lncRNA" /gene="LOC117283624" /product="uncharacterized LOC117283624" /db_xref="GeneID:117283624" ORIGIN // ctgataatggatctgagaagacttctagactccagtgtcaggctgtcttcaagaagagattgagagacccctgatttcgggaacgtacatacaacatgaagttgggccaccctttaactgactatggatcttacaactatatctgcaaagtggaggagcttgaacagtcttctgtaagcttttctggatgtgctgttgatcgatcccacccacctggctcattcagcatgagagaggtgatgaaatggatggaagaaaaccaccagcctgcccatgtgaaaatatgagaactgggaattcattttggaatattgttggagtc
position 50
XR_004514658.1 - Fukomys damarensis (Damara mole-rat) - NCBI
Penicillium coprophilum Ankyrin and HET domain protein (N7500_004370), partial mRNA. (261 bp)
Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgatgaatgaaccgacgaatatcagtcgtccagtactctttcgagctcgggaaggtcttccaggcaaaggcaccaagaatcgtgcaggaaaaggcgatgaggtgtggctcattgctggaatgccgaccccagttgtgttgcgaaagacagagcgtgaggattgtttcacaagaactgatattgtctatgttcacgggatcatgcatggagaattgtttgaccagaaagatcgtatacaagaagagattgagctcatctag
position 238
XM_056675516.1 - Penicillium coprophilum - NCBI
Saccharomyces eubayanus RPL36B-like protein (DI49_5219), partial mRNA. (246 bp)
of Genetics, University of Wisconsin-Madison, 425-G Henry Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atgactccagctccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcatcagagccaaggctaaggtcgaggaaatgaacaacatcatcgctgcttctcgtcgtcattaa
position 162
XM_018368212.1 - Saccharomyces eubayanus - NCBI
Penicillium chrysogenum uncharacterized protein (N7489_003630), partial mRNA. (270 bp)
NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 270) AUTHORS Petersen,C. TITLE Direct Submission JOURNAL Submitted (01-DEC-2022) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgggtccaatggcacacaaccagaagctgcaagaagagattgttgtgactagtttgactttgtcctaccaaatggcggtacggaccggtactatcctcaatttggctggggccctcattgctcgtcccggacatgagcctaaggctggcagctcggccgccaggactgttcctttctcttcctctcgggaatccactgcgattgggcaaccacaggctgaggcttctgaacagcctgctaatggaactcaacctcaatcggctatctaa
position 31
XM_056709385.1 - Penicillium chrysogenum - NCBI
Candida parapsilosis uncharacterized protein (CPAR2_104710), partial mRNA. (333 bp)
Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 333) AUTHORS Guida,A. TITLE Direct Submission JOURNAL Submitted (19-OCT-2011) to the INSDC atgttcagaccaattgcccgtatatcatcaagaagattgttttcaatcactcctagaagatcaaacttgattggagacttgtatgtccaaaacattagacaattcaaaccacaagccctttcacaagaagagattgattccgcagttaagaagtttcaattaccaggtaaaccaaccattccacaaattcacgaattgtcaactgaacaagttaaagagtatgagcaaaatgaagttgaagctgaggctgcacaaccaactgaagctaattctgaaactaaaccagatgaagattggtttgtttttgatgaagttgaagctgaaggacattag
position 124
XM_036812515.1 - Candida parapsilosis - NCBI
Caenorhabditis remanei uncharacterized protein (GCK72_025216), partial mRNA. (285 bp)
A.A., Willis,J.H. and Phillips,P.C. TITLE Direct Submission JOURNAL Submitted (19-DEC-2019) Institute of Ecology and Evolution, University of Oregon, 5289 University of Oregon, Eugene, OR 97403, USA atgtccggcaataaaagtgaaacgacagaaagtggaaaaactacgttgccgcatgaacgactgattgaagcatacaaccgaaggtttgaaattcaagaagagattgatgttatgaccaaaactacggatggctaccaatccaggaaatttgaccaattgacaatgcagctcacctatgttgacaatatcatctcaattggggagagcgactttgataagaaacgtgccgccaccgtgggaaagttgttcgctgtattgaggactctccaacattctaacaactaa
position 94
XM_053736243.1 - Caenorhabditis remanei - NCBI
PREDICTED: Tripterygium wilfordii uncharacterized LOC119996202 (LOC119996202), mRNA. (351 bp)
Plant transposase (Ptta/En/Spm family); Region: Transposase_24; pfam03004" /db_xref="CDD:367291" ORIGIN // atgcaaagggttcgaaaaagggaggatgatggtgaatggattcaagaggaagccaaagttgcgcttgaaaagctttgggtggaaccggattatgtgaagaaaagggataaggcaatgatgaaccgagcatccgagactggcgggtgcactaatactggtggctctattccacactcggaacacaagaagagattgaatgattacaacaagctgaaggaagcctgttctagtcaagcatcgacctctggagagtcacctcttgaaccgcaggatgatgattccatattcatggaggtgactaagtgggtcaataagaaaggtcgtgtctacggtcttggatcaaaggcgtga
position 183
XM_038842755.1 - Tripterygium wilfordii - NCBI
Exophiala aquamarina CBS 119918 hypothetical protein partial mRNA. (288 bp)
Cambridge, MA 02142, USA atgccagacaatccacagtttcttggaccactactcccgcaacacattgccgaaaccatcaacgtcagcattggacccagtggcgagaacagggagtatctcttgcatctccaagatgccctagaagctctgagtgctcacagccatgacgaacatattgccgatctagcacgaagagtgcgtgctttggatccacctacgcggccggcatgtccttcttcaatcggccacgacttgaggaagattaacagcaccgaagaacaagaagagattgagaaggatacatga
position 262
XM_013407183.1 - Exophiala aquamarina CBS 119918 - NCBI
PREDICTED: Papaver somniferum uncharacterized LOC113332400 (LOC113332400), ncRNA. (267 bp)
LOC113332400" /product="uncharacterized LOC113332400" /db_xref="GeneID:113332400" ORIGIN // gaagaagctggcagcactgaaaccagagaatagcactgtcaatgagtgggaagagttcgtgaaacatgtttgctcggaggaattcagaacaaaaagattctggatgcaacaaatcaggaagaaatacaccactccacacactatcagtagactgggttgggtgagactcgaggctaagatgcaaaaggaacggaaaacacaagaagagattgatagagtcgaagtttggacaacgggtcacaaacataaggaaggaaaggaacctaa
position 200
XR_003351493.1 - Papaver somniferum (opium poppy) - NCBI
[Candida] auris 60S_ribosomal_protein_L36 (CJI96_0003372), partial mRNA. (300 bp)
Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaaagatctcccagagaaagggcgccctttcccagagaaccaagttcgtcagaagcattgtgtctgaggtttccggcttggctccatacgagagaagattgatcgagttgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggttgaggagatgaaccagatcattgctgagtccagaagacactaa
position 216
XM_029032793.1 - [Candida] auris - NCBI
Spathaspora passalidarum NRRL Y-27907 hypothetical protein (SPAPADRAFT_55114), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggctaagtcaggtattgctgctggtttaaacaagggtcacaagactaccgctaaggaagtcgctccaaaggtttcctacagaaagggtgctttaagtaagagagctgactttgtcagaaacatcgtcaaggaagttgctggtttagccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagctttaagaaaggttgaagaaatgaacaaggtcattgctgaatctagaagacactaa
position 216
XM_007374654.1 - Spathaspora passalidarum NRRL Y-27907 - NCBI
Candida theae rpl36 (KGF57_004121), partial mRNA. (300 bp)
Supercomputing Center, Carrer Jordi Girona 29, Barcelona 08034, Spain atggctaagtcaggaattgcagtaggtttaaacaaaggccacaaggttgccaccaaggaagttgccccaaagatttcgtacagaaagggtgccttgtcacaaagaaccacttttgttagatcaatcgttaaagaagttgccggattggctccatacgaaagaagattgattgaattgattagaaatgccggtgagaagagggctaagaagttggccaagaagagattgggtactcacaagagagccggaaagaaggttgaagaaatgaacaagatcattgctgaatcaagaagacactaa
position 216
XM_051753611.1 - Candida theae - NCBI
PREDICTED: Haliotis rubra uncharacterized LOC124281168 (LOC124281168), ncRNA. (343 bp)
lncRNA" /gene="LOC124281168" /product="uncharacterized LOC124281168" /db_xref="GeneID:124281168" ORIGIN // gtgcacatcaaggttttgaccaattctgcagaagacttgaaacgcttggcgtattaggagcgctaaaacatcatggaacacgcatgaaagaagtttttgtatatgaaaaaaggcttctggattctacaacaatagaactattgttcgagccagatttagcagaggccaactccaaccgacgccgccaagaagagattgttctctcaaactggagagattttcttcttgatttggaagaaggtacggaagtccccacactcaaagacctcttggtgtttgtgaccggggctgacggaatcccgcctctgggattcgacccctctccacacctgctgtttcactc
position 186
XR_006899862.1 - Haliotis rubra (blacklip abalone) - NCBI
Komagataella phaffii GS115 60S ribosomal protein L36 (PAS_FragB_0036), partial mRNA. (306 bp)
/ Gent University, Technologiepark 927, Ghent, 9052, BELGIUM atgagaaatattgtactaacaaattcaggtattgcagtaggtgctaacaagggacacaaggtcaccccaaaggccgttgctccacaaaagagagtcgctatcagccaaagaactgactttgttagaaagttggtccgtgaggtcactggtctgtctccatacgaaagaagaatcattgagttgatcagaaactctggtgagaagagagccagaaagttcgccaagaagagattgggtactcacaccagagctaaggctaagttggaagagatgcaaaacgttatccaggaagcaaagcgtcattaa
position 222
XM_002490801.1 - Komagataella phaffii GS115 - NCBI
Cryptosporidium muris RN66 prefoldin subunit 2, putative, mRNA. (372 bp)
Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, USA REFERENCE 2 (bases 1 to 372) AUTHORS Silva,J.C. TITLE Direct Submission JOURNAL Submitted (02-MAY-2007) The Institute for Genomic Research, 9712 Medical Center Drive, Rockville, MD 20850, USA atggttgagacaggatatactaaggagacacaagaagagattgttcaactagataagaaactcaaactactaaacaataagatttcagagcttactcaagatagtaaagagtatggtctagtcttaaatgcatttgagaaggtagacgagaaccgacgatgttttagagttattggtggtgtgatggttgagagaaatgttaaaactgttaaacctgctcttgaaaaagaaaagagtgcgttagatagtgcaatttccgaattagagaagcagtatgaatctattgaagaggaaatgaagaatctaattgagaaatatagtacaaatagtgctgatcc...
position 31
XM_002141116.1 - Cryptosporidium muris RN66 - NCBI
[Candida] duobushaemulonis 60S ribosomal protein L36 (CXQ87_004317), partial mRNA. (300 bp)
for Disease Control and Prevention, 1600 Clifton Road, Atlanta, GA 30329, USA atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacggtaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctgagaaaggtcgaggagatgagtcagatcatcactgagtccagaagacactaa
position 216
XM_025482761.1 - [Candida] duobushaemulonis - NCBI
Echinococcus granulosus hypothetical protein (EGR_02867), partial mRNA. (285 bp)
Key Laboratory of Health and Disease Genomics, Chinese National Human Genome Center at Shanghai, No. 250 Bibo Road, Shanghai 201203, China atgtcaatttatgtggagcaaatgaggtcaaaatacacgtatttacgaatacgtatgcaacgttctaattcggtttgtcgcagtacgacttcaaaaaccaagtggtatttgtccttttgtcactggatggcagttgtttatggcagagtgtcaagaagagattggttggattctaagcaccaaataaatcaagaacttgaggatgcattagcatcactagccaaaccacaatctccctcaggacaaatgagggcaataagcttgaagaatttaccttctctgtga
position 152
XM_024492116.1 - Echinococcus granulosus - NCBI
Metarhizium robertsii ARSEF 23 Fungal transcriptional regulatory protein mRNA. (273 bp)
Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fenglin Road, Shanghai, Shanghai 200032, China atgattgctctcaagtcgtggaaaaagtctgaacgggtccgctgggacggaaataagcatagtcctgaggagacggctggcttgtttggtctcggtgccctttcatggcttaacccgctctcgttggcaggatacaagaagagattggccctagaggacttgtaccgcctcgattgcaacttggcatcagagcatctgcaggtcaatcacccgcctgtgtcaacagtctgcgcagtagccctgggaaacgttacggtctggccagagcgctga
position 135
XM_011412523.1 - Metarhizium robertsii ARSEF 23 - NCBI
Scheffersomyces stipitis CBS 6054 60S ribosomal protein L36 partial mRNA. (288 bp)
US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA ggaattgctgttggattaaacaagggtcacaagactaccgctaaggaagttgctccaaagatctcttacagaaagggtgctctttccaagagaaccgacttcgtcagaaacatcgtcaaggaagttgctggcttagccccatacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagaaatgaacaaggtcattgctgaaaccagaagacactaa
position 204
XM_001383429.1 - Scheffersomyces stipitis CBS 6054 (Pichia stipitis CBS 6054) - NCBI
PREDICTED: Haliotis rubra uncharacterized LOC124288830 (LOC124288830), transcript variant X2, mRNA. (360 bp)
gtggtgaagttatctcaggccgaggattacacggcctttgaagacctgattcagatggcaggttgtatatccatggtccatacgctgagcaggcgacaagaaatgtgcaaggcacatcaaggttttgaccaattctgcagaggacttgaaacgcttggcgtattaggagcgctaaaacatcatggaacacgcatgaaagaagtttttgaatatgaaaaaaggcttctggattctacaacaatagaactattgttcgaagcagatttagcaaaggccaactccaaccgacgccgccaagaagagattgttctctcaaactagagaga
position 329
XM_046725384.1 - Haliotis rubra (blacklip abalone) - NCBI
Kuraishia capsulata CBS 1993 uncharacterized protein (KUCA_T00004322001), partial mRNA. (318 bp)
atgatacaacaacgctttgaggttgaagacagtatcgccgctggtgttaacaagggtcacaaagtgaccgctaaggaggttgccccaaaaatctcgtacagaaagggtgctttgtccaagagaaccgccttcgtcagagacattgtccgtgaagtgtccggtttggctccatacgagagacgtgtcattgagttgatcagaaatgctggtgagaagcgtgccaagaagctggccaagaagagattgggaactcacttgagagccaaggccaaggttgaggagatgaacaagatcatccaagagtctagacgtcactaa
position 234
XM_022601045.1 - Kuraishia capsulata CBS 1993 - NCBI
[Candida] pseudohaemulonii 60S ribosomal protein L36 (C7M61_002398), partial mRNA. (300 bp)
Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggtcgaggagatgaaccagatcatcactgagtccagaagacactaa
position 216
XM_024857773.1 - [Candida] pseudohaemulonii - NCBI
Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 ribosomal protein L36e (METBIDRAFT_76691), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggcccaaaccggtattgctgtcggtttgaacaagggtcacaaaaccacccaaaaggaagttgttccaagactttcccgcaagaagggagtcttgtccaagagagctgctttcgtcagaagcattgtctctgaggtctccggcttggccccatacgagagaagattgatcgagttgatcagaaacgccagcgagaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgagaaaggttgaggagatgaacaagatcattgctgagtctaagagacactaa
position 216
XM_018858572.1 - Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 - NCBI
Lachancea lanzarotensis LALA0S05e07514g1_1 (LALA0_S05e07514g), partial mRNA. (303 bp)
UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850, France atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcaacgccatgaccccaaccccaaagatctcctacagaaagggtgcttcttccaacagaaccaagttcgtcagatctttggtcaaggaagttgccggtttggccccatacgaaagaagattgatcgatttgatcagaaacgctggtgaaaagagagccagaaaggtggccaagaagagattgggtaccttcggcagagccaaggccaaggtcgaggagatgaacgacatcatcaccgcttctcgtcgtcattaa
position 219
XM_022772423.1 - Lachancea lanzarotensis - NCBI
Saccharomyces eubayanus RPL36A-like protein (DI49_4277), partial mRNA. (303 bp)
Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atggccgctaagacaggaatcgcaattggtttgaacaaaggtaagaaggtcactagcatgaccccagccccaaagatctcttacaagaagggtgctgcttccaacagaactaagttcgtcagatctttggttagagaaatcgccggtttgtctccatacgaaagaagattgatcgatctaataagaaactctggtgaaaagagagctagaaaggttgccaagaagagattgggttctttcatcagagccaaggctaaggttgaagaaatgaacaacattatttctgcttctcgtcgtcactaa
position 219
XM_018367307.1 - Saccharomyces eubayanus - NCBI
Kazachstania naganishii CBS 8797 hypothetical protein (KNAG0D00710), partial mRNA. (303 bp)
of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND atggccgtcaagactggtattgctgttggtttgaacaagggtaagcaggtcaatgctatgaccccagccccaaagatgtcctacaagaagggtgccatctctaacagaacccagttcgtccgctcgctggtgaaggagatcgctggtctgtccccatacgaaagaagactgatcgacttgatcagaaactctggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaagagagccaaggccaaggttgaggagatgaacaacgtcatcgctgcctctcgtcgtcattga
position 219
XM_022607478.1 - Kazachstania naganishii CBS 8797 - NCBI
[Candida] glabrata 60S ribosomal protein L36 (CAGL0K10906g), partial mRNA. (303 bp)
Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr E-mail:david@labri.fr atggccgttaagactggtattgctgttggtttgaacaagggtactaaggtcacccaaatgaccccagccccaaagatctcttacaagaagggtgctgcttctaacagaaccaagttcgttcgttctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagctaaggctaaggttgaagaaatgaactccatcattgctgcttctcgtcgtcactaa
position 219
XM_002999537.1 - Nakaseomyces glabratus (Candida glabrata) - NCBI
Eremothecium gossypii ATCC 10895 60S ribosomal protein L36 (AGOS_AFL163C), partial mRNA. (303 bp)
Biozentrum, Klingelbergstrasse 50, Basel CH-4056, Switzerland atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaccccaatgacccctgctccaaaggtctcttacagaaagggtgcctcctccaagagaaccaccttcgtcagatctatcgtcagagaggttgccggcatggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggcacctttggcagagctaaggctaaggttgaggaaatgaacgagatcattgctgcttctagacgtcactag
position 219
NM_210741.1 - Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895) - NCBI
Tetrapisispora blattae CBS 6284 hypothetical protein (TBLA0A02360), partial mRNA. (303 bp)
of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND atggctgtcaaaactggtattgctgttggtttgaacaaaggtaagcaggtcgtctctatgaccccagctgccaagatctcatacaagaagggccaatcttctcaaagaaccaagttcgtcagatctttggtcagagaaatcgctggtttagctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggttgaagaaatgaacaacatcattgctgcctctcgtcgtcattag
position 219
XM_004177506.1 - Tetrapisispora blattae CBS 6284 - NCBI
Lachancea thermotolerans CBS 6340 60S ribosomal protein L36 partial mRNA. (303 bp)
FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr) atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcacccagatgaccccagccccaaagatctcgtacagaaagggtgcttcctctaacagaaccaagttcgtcagatctttggtcaaggaggtcgccggtttggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggtactttcggcagagccaaggctaaggtcgaggagatgaacgacatcatcaccgcctctcgtcgtcactaa
position 219
XM_002555947.1 - Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS - NCBI
Eremothecium cymbalariae DBVPG#7215 Hypothetical protein partial mRNA. (303 bp)
Laboratory, Gamle Carlsberg Vej 10, Copenhagen V DK-1899, Denmark atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaactcgatgaccccagccccaaagatctcttacagaaagggtgcttcttccaagagaacggagtttgttagatctattgtcaaggaagtcgccgggttggctccatacgagagaagattgcttgatttgatcagaaactctggtgagaagagagccagaaaggttgccaagaagagattgggtacttttggcagagcaaaggctaaggttgaagaaatgaacaacgtcattgctgcttccagacgtcactga
position 219
XM_003644656.1 - Eremothecium cymbalariae DBVPG#7215 - NCBI
Candida theae ATP14 (KGF57_002550), partial mRNA. (333 bp)
V. and Gabaldon,T. TITLE Direct Submission JOURNAL Submitted (08-JUL-2021) Life Sciences, Barcelona Supercomputing Center, Carrer Jordi Girona 29, Barcelona 08034, Spain atgttcagaccaattgctcgtatatcatcaagaagattattttcaatcaccccaagaagatcaaacttgattggtgacttgtacgtccaaaacattagacagttcaagccacaagccctttcacaagaagagattgatgccgctgtaaaaaagtttcaattgccaggtaagccaaccattccccaaatccacgagttgtcaactgaacaagttaaagagtatgaacagagtgaagttgaagctgaagctgcacaaccaactgaaaatgactctgaaactaagccagatgaagattggtttgtttttgatgaagttgaggctgagggccattaa
position 124
XM_051751876.1 - Candida theae - NCBI
Saccharomyces cerevisiae S288C ribosomal 60S subunit protein L36B (RPL36B), partial mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagccccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatatgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
position 219
NM_001184312.1 - Saccharomyces cerevisiae S288C - NCBI
Saccharomyces cerevisiae S288C ribosomal 60S subunit protein L36A (RPL36A), partial mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa
position 219
Synonym: RPL39B
NM_001182701.1 - Saccharomyces cerevisiae S288C - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/caagaagagattg
lang : ja | div : | spe : | query_string : caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.150 | 0.150 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=(nt:caagaagagattg)?to=0&format=json
0.308 | 0.158 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=(nt:caagaagagattg)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.313 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]