GGRNA ver.2 Help | Advanced search | English    旧バージョン

2021-12-06 11:22:03, GGRNA : RefSeq release 208 (Sep, 2021)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Leptosphaeria maculans JN3 hypothetical protein (LEMA_P077180.1), partial mRNA. (429 bp)
LEMA_P077180.1" /db_xref="GeneID:13292782" CDS 1..429 /locus_tag="LEMA_P077180.1" /codon_start=1 /product="hypothetical protein" /protein_id="XP_003843608.1" /db_xref="GeneID:13292782" /db_xref="UniProtKB/TrEMBL:E5A934" /translation="MRYSLTLMGLATLGFHILPSLSAAVPASNLALRSNTIDKRHVYTVDEDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELA" ORIGIN // REFERENCE 1 (bases 1 to 429) AUTHORS Rouxel,T., Grandaubert,J., Hane,J.K., Hoede,C., van de Wouw,A.P., Couloux,A., Dominguez,V., Anthouard,V., Bally,P., Bourras,S., Cozijnsen,A.J., Ciuffetti,L.M., Degrave,A.,...
AA_position 60
XM_003843560.1 - Leptosphaeria maculans JN3 - NCBI
PREDICTED: Octopus sinensis stress response protein NST1-like (LOC115230060), mRNA. (609 bp)
method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:115230060" CDS 1..609 /gene="LOC115230060" /codon_start=1 /product="stress response protein NST1-like" /protein_id="XP_029656445.1" /db_xref="GeneID:115230060" /translation="MNRYDELVRRTDESVRRKDESVRSKDESVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDELVRRTDESVGRKDESVRSKDEPVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDESVRRKDESVQRKDESVRCKDESVQRKDELVRRKDESVRRKDESWNAGCGEYHAQLK" misc_feature <46..573 /gene="LOC115230060" /note="MAEBL; Provisional; Region: PTZ00121" /db_xref="CDD:173412" ORIGIN //...
AA_position 32
XM_029800585.1 - Octopus sinensis (East Asian common octopus) - NCBI
PREDICTED: Drosophila pseudoobscura trichohyalin (LOC26532712), mRNA. (2589 bp)
protein_id="XP_033235173.1" /db_xref="GeneID:26532712" /translation="MLNICIILLVFFNLTENLTRGSDFHENQESCFVSRELEDQCASVCYPTVKPLLKYMGICHQKDLQISGIQNQLQDQNEKVTKYKTQVEFLNKKLVDERSSSGLKNDLKETIDKVQNLRLELSGELKKLNRQKNNTVKDLNEEIDRLKLQLTSKELKEKNMEEKVEILKKKNSTLKNLQEEIANVKMQLKRKDEQNEKTMIEKDEIIKQKDKTMEEKDELLKQKEKIMEEKDELLKKKDSTLKNLQEEIANVKIQLKRKDEQNEKTMIEKDEIIKQKDKTMEEKDELLKQKEKIMEEKDELLKKKDSTMKDLQEGIANVKIQLKSKDELLKQNEKTMIEKDELLKQKEKNMEEKDELLKKKEKNMEEKDELLKKKDNTLKNLQEEIANVKMQLKRKDEQNEKTMIEKDEIIKQKEKTMEEKDELLKQKKKIMEEKDELLKKKDSTMKDLQEEIANVKIQLKSKDELLEQNEKKIIEKNELLKQKEKNMEEMDELLKQKEKIMEEKDELLKKKDSTMKDLQEEIANVKIQLKS...
AA_position 216
XM_033379282.1 - Drosophila pseudoobscura - NCBI
PREDICTED: Diabrotica virgifera virgifera uncharacterized LOC114330671 (LOC114330671), mRNA. (1600 bp)
samples with support for all annotated introns" /db_xref="GeneID:114330671" CDS 36..1454 /gene="LOC114330671" /codon_start=1 /product="uncharacterized protein LOC114330671" /protein_id="XP_028135879.1" /db_xref="GeneID:114330671" /translation="MTFRIVALLIMVTAFASLTQSSPLLIGHGVDKVHDASGDGESHLTKDELLKSHDTFGYGEVPLTKYELLKAHDAFGDGESHLTKDELLKAHDAFGDGEAHLTKDELLKAHDAFGDGESHLTKDELLKSHDTFGYGEVPLTKYELLKAHDAFGDGESHLTKDELLKSHDTFGYGEVPLTKYELLKAHDAFGDGESHLTKDELLKSHDTFGYGEVPLTKYELLKAHDAFGDGESHLTKDELLKSHDTFGYGEVPLTKYELLKAHDAFGDGESHLTKDELLKSHDTFGYGEVPLTKYELLKAHDAFGDGESHLTKDELLKSHDTFGYGEVPLTKYELLKAHDAFGDGESHLTKDELLKS...
AA_position 46
XM_028280078.1 - Diabrotica virgifera virgifera (western corn rootworm) - NCBI
PREDICTED: Cottoperca gobio putative leucine-rich repeat-containing protein DDB_G0290503 (LOC115007503), mRNA. (1684 bp)
substituted 1 base at 1 genomic stop codon" /codon_start=1 /transl_except=(pos:814..816,aa:OTHER) /product="LOW QUALITY PROTEIN: putative leucine-rich repeat-containing protein DDB_G0290503" /protein_id="XP_029286273.1" /db_xref="GeneID:115007503" /translation="MIQMREVTKSNSERETNIILLHSSYNNLTEEKDELQTRHNNLTKEKDELQTKYNNLTKEKDQLQTRHNNLTEEKDQLQTRHNNLTEEKDELQTRHNNLTEEKDELQTRHNNLTEEKDELQTRYNNLTEEKDELQTRYNNLTKEKDELQTRYNNLTEEKDELQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTRYNNLTEEKDELQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTSYNNLTKEKDQLQTRYNNLTEEKDELQTSYNNLTKEKDXLQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTSYNNLTK...
AA_position 32
XM_029430413.1 - Cottoperca gobio - NCBI
Rhizophagus irregularis DAOM 181602=DAOM 197198 hypothetical protein (GLOIN_2v1524752), mRNA. (289 bp)
locus_tag="GLOIN_2v1524752" /db_xref="GeneID:36864093" CDS 43..249 /locus_tag="GLOIN_2v1524752" /note="expressed protein" /codon_start=1 /product="hypothetical protein" /protein_id="XP_025186518.1" /db_xref="GeneID:36864093" /db_xref="JGIDB:Rhiir2_1_1524752" /translation="MKIQKPKKKIKNKIKQTKDELNDKLEHTKDELYDKLEQTKDELKQELKEVKTLLTNLINNLNINSNNI" ORIGIN // REFERENCE 1 (bases 1 to 289) AUTHORS Chen,E.C.H., Morin,E., Beaudet,D., Noel,J., Yildirir,G., Ndikumana,S., Charron,P., St-Onge,C., Giorgi,J., Kruger,M., Marton,T., Ropars,J., Grigoriev,I.V., Hainaut,M., Henrissat,B., Roux,C., Martin,F. and...
AA_position 18
XM_025313793.1 - Rhizophagus irregularis DAOM 181602=DAOM 197198 - NCBI
PREDICTED: Cottoperca gobio GRIP domain-containing protein RUD3-like (LOC115010807), mRNA. (2398 bp)
CDS 22..951 /gene="LOC115010807" /codon_start=1 /product="GRIP domain-containing protein RUD3-like" /protein_id="XP_029291462.1" /db_xref="GeneID:115010807" /translation="MASGNTGPNCTVSSADVMDEMSIYVNVERPSGCHSQRKRKINISENIYENVSLLTLGPNRTGTAPSGAEEVKKNSCRAAAVCLGLLCLLLLAGLITLVCIFTKSNSERETNIILLHSSYNNLTKEKDELQTRHNNLTKEKDQLQTRYNNLTKEKDQLQTRYNNLTKEKDQLQTSYNNLTEEKDELQTRHNNLTEEKDELQTRHNNLTEEKDELQTRYNNLTKEKDELQTRHNNLTKEKDQLQTRYNNLTKEKDQLQTSYNNLTKEKDQLQTRYNNLTKEKDQLQTSYNNLTEEKDELQTSYNNLTKEKD" misc_feature 948 /gene="LOC115010807" /note="Chromosome segregation ATPase...
AA_position 126
XM_029435602.1 - Cottoperca gobio - NCBI
PREDICTED: Drosophila miranda trichohyalin-like (LOC108161194), mRNA. (1954 bp)
gene="LOC108161194" /codon_start=1 /product="trichohyalin-like" /protein_id="XP_033249082.1" /db_xref="GeneID:108161194" /translation="MLNIFIIVLVFFNLSENLTRGSDFHENQESCFVSRELEDQCAAVCYPTVKPLLKYMGICHQKDLQISGMQNQLQDQNEEVTKYKTQVEILNKQLVDKRSSSGLKNDLKETIDKVQNLRLELSEELKKLYRQKNNTVKDLHEEIANVKMQLKSKDELLEQNEKTMIEKDELLKQKEKNMEEKDELLKKKEKNMEEKDGLLKKKDSTLKNLQEEIANVKMQLTRKDELLKENEKTMTEKDELLKQKEKNMEEKDEILKHKDSPMKDLHEEIANVKIQLTRKDELLDQKEKTMIEKDELLKQMEKNMEEKDEMLKQKEKKMEENDELLKQKEKNMEEKDEMLKQKEKNMEEKDEMLKQKEKKMEENDELLKQKEKNRDEKDELLKKKDSTMKDLHEEIANVKIQLRSKDEFLEQKEQKKEQFIRPILDNADPKTSETHTIDVPLKEPDESGWTIILQELEGLASLEKK...
AA_position 153
XM_033393191.1 - Drosophila miranda - NCBI
PREDICTED: Sebastes umbrosus C-type lectin domain family 4 member M-like (LOC119494692), transcript variant X1, mRNA. (2793 bp)
genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns" /db_xref="GeneID:119494692" CDS 16..1494 /gene="LOC119494692" /codon_start=1 /product="CD209 antigen-like isoform X1" /protein_id="XP_037636689.1" /db_xref="GeneID:119494692" /translation="MYSSLQREKDELQTNKDQQQTRYSSLQREKDELQTNKDQLQTRYSSLQREKDELQTNKDQLQTRYSSLQREKDELQTLSVTLRANRDQLQSNYSSLKTNKDQLQRSYNTLSISRNHIQTSYNSSQKDKERLQSSYNSLQKEKEQLQQSYSSLTTERDDFKTSSNNLKSERNQLQARYNTLKQESNQLQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQREKDTLQTLSVMLKANRDLLQRNYSSLKINKDQLQRSYNTLSLSKMSL...
AA_position 9
XM_037780761.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
Phaseolus vulgaris hypothetical protein (PHAVU_007G166300g) mRNA, complete cds. (2020 bp)
db_xref="Phytozome:Phvul.007G166300.1.p" /db_xref="GeneID:18626115" /translation="MMKNQPSQWWWLESHNNTRRSPWLQSTLTELNEKTKAMLKLIEEDADSFAQRAEMYYKKRPQLVSMVEDFYRTHRSLVERYDQVTGIRQQKTGGSPFSPLKHHQPEKLMSFTDDNYDSYYESCDVEESGESEIDDPEQEEEEDTKFNNNAELEEVQFVAANDVMEIERLGEENKDHNDHNKQKYNIYEAVMLREEIEQLRKENRVQKDELNPKSIICGELLMLREEIGRLGKENRAEKDELNQKDIICGEAMMLREEIEQLGKENRVLKDEINQKSIICGEVMMLREEIEQLRKENRGQKDELNQKDIICGEAMLLREEIEQLGKENRVLKDELNQKSIICGEVMMLREEIEQLRKENREHKDELNQKDNICGEIMMLREEIEQLGKENGALKDELNQKYIICGEVMMLREEIQQLRKENRGQKDELDQIDINSEVTMSREEIEVYIKENRVKNDELKPKGNVCGEVVMLREEIERLRKDERAQKSTLCGEVMKLKQENSAQKDHLKKKDQEKIEVIR...
AA_position 207
XM_007144500.1 - Phaseolus vulgaris - NCBI
Thermothielavioides terrestris NRRL 8126 uncharacterized protein (THITE_2118256), mRNA. (977 bp)
locus_tag="THITE_2118256" /db_xref="GeneID:11524225" CDS 281..721 /locus_tag="THITE_2118256" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_003654994.1" /db_xref="GeneID:11524225" /db_xref="JGIDB:Thite2_2118256" /translation="MQLKNLAFVAPLLLAIAHSAPTQTGEIAKKGELVKDADEIWLWKKDELQKDADAIWLWKKDELTKDADEIWLWKRGELKAKLQKDADEIWLWKKDELAKDSDEIWLWKKGELKGKLQKDADEIWLWKKDQLGSKKLVKDADEIWLW" misc_feature 709 /locus_tag="THITE_2118256" /note="MAEBL; Provisional; Region: PTZ00121" /db_xref="CDD:173412" ORIGIN // REFERENCE 1 (bases 1 to 977) AUTHORS Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A...
AA_position 45
XM_003654946.1 - Thermothielavioides terrestris NRRL 8126 - NCBI
Guillardia theta CCMP2712 hypothetical protein (GUITHDRAFT_149441) mRNA, complete cds. (891 bp)
tag="GUITHDRAFT_149441" /codon_start=1 /product="hypothetical protein" /protein_id="XP_005818182.1" /db_xref="JGIDB:Guith1_149441" /db_xref="GeneID:17287922" /translation="MEQRSGRDSNRPDYLAQALAKVAQAQQEFFAKSGDVEKARALVRLREAEHDLTVLKGADSELEGDKKRAEAQVRLRKEQLRLAELEGDKKKTAEAQVRLRKEQLRLAELEDDKKKTAEAQVRLSKDELKLAELEGNKKKTAEAQVQLSKDELKLAELEGDDKKTAEAQVQLSKDELKLAKFEGNKKKTAEAQVQLSKEELKLAKFEGNDKKTAEAQVQLSKDELKLAKFEGDEELAHAKRNLTEANLNLSVATVSELLRNATGEDAARLSRELEVASVMAQASSFQFCVKWPLKST" misc_feature 49..>885 /locus_tag="GUITHDRAFT_149441" /note="chromosome segregation protein SMC, common bacterial type; Region: SMC...
AA_position 125
XM_005818125.1 - Guillardia theta CCMP2712 - NCBI
PREDICTED: Vigna angularis protein NETWORKED 4B (LOC108325156), transcript variant X3, mRNA. (1956 bp)
protein NETWORKED 4B" /protein_id="XP_017413662.1" /db_xref="GeneID:108325156" /translation="MMKNQPSQWWWLESHSNTRRSPWLQSTLTELNEKTKAMLKLIEEDADSFAQRAEMYYKKRPQLVSMVEDFYRTHRSLAERYDQIAGIRQQKTGGSPFSPLKHHQPEKLISFANDCYDSYSESCDVEESGESEIDDPEQEEEEDSIFNNCAQLEEVQFERLGEENKDHKGQNKQKYNIYEAVMLREEIEQLRKENRVQKDELDRKSITFVELMMLREEIEQLRKENRAQKDELNQKDIICGEAMMLREEIEQLGKENRVLKDELSQKSIICGEVMMLREEIEQFRKENRTQKHELNQKDIICGKAMMPREEIEQLSKENRVMKDELNQKSIICGEVMMLKEEIEQLRKENRAQKDELHQKDNICSEIMMLREEIGQLGKENAALKDELNKKYIICGEIMMLREEIEQLRKYNRGQKNELHQKGIKCEVTMSREEKENRVKNDELNPEDSVCGEVVMLREEIKRLEKDERAQKGTLSGEVMKLRQENSAQKDHLKQKDQEKIEVIRHLS...
AA_position 198
XM_017558173.1 - Vigna angularis (adzuki bean) - NCBI
PREDICTED: Vigna angularis protein NETWORKED 4B (LOC108325156), transcript variant X2, mRNA. (1985 bp)
protein NETWORKED 4B" /protein_id="XP_017413661.1" /db_xref="GeneID:108325156" /translation="MMKNQPSQWWWLESHSNTRRSPWLQSTLTELNEKTKAMLKLIEEDADSFAQRAEMYYKKRPQLVSMVEDFYRTHRSLAERYDQIAGIRQQKTGGSPFSPLKHHQPEKLISFANDCYDSYSESCDVEESGESEIDDPEQEEEEDSIFNNCAQLEEVQFERLGEENKDHKGQNKQKYNIYEAVMLREEIEQLRKENRVQKDELDRKSITFVELMMLREEIEQLRKENRAQKDELNQKDIICGEAMMLREEIEQLGKENRVLKDELSQKSIICGEVMMLREEIEQFRKENRTQKHELNQKDIICGKAMMPREEIEQLSKENRVMKDELNQKSIICGEVMMLKEEIEQLRKENRAQKDELHQKDNICSEIMMLREEIGQLGKENAALKDELNKKYIICGEIMMLREEIEQLRKYNRGQKNELHQKGIKCEVTMSREEKENRVKNDELNPEDSVCGEVVMLREEIKRLEKDERAQKGTLSGEVMKLRQENSAQKDHLKQKDQEKIEVIRHLS...
AA_position 198
XM_017558172.1 - Vigna angularis (adzuki bean) - NCBI
PREDICTED: Vigna angularis protein NETWORKED 4B (LOC108325156), transcript variant X1, mRNA. (2002 bp)
protein NETWORKED 4B" /protein_id="XP_017413660.1" /db_xref="GeneID:108325156" /translation="MMKNQPSQWWWLESHSNTRRSPWLQSTLTELNEKTKAMLKLIEEDADSFAQRAEMYYKKRPQLVSMVEDFYRTHRSLAERYDQIAGIRQQKTGGSPFSPLKHHQPEKLISFANDCYDSYSESCDVEESGESEIDDPEQEEEEDSIFNNCAQLEEVQFERLGEENKDHKGQNKQKYNIYEAVMLREEIEQLRKENRVQKDELDRKSITFVELMMLREEIEQLRKENRAQKDELNQKDIICGEAMMLREEIEQLGKENRVLKDELSQKSIICGEVMMLREEIEQFRKENRTQKHELNQKDIICGKAMMPREEIEQLSKENRVMKDELNQKSIICGEVMMLKEEIEQLRKENRAQKDELHQKDNICSEIMMLREEIGQLGKENAALKDELNKKYIICGEIMMLREEIEQLRKYNRGQKNELHQKGIKCEVTMSREEKENRVKNDELNPEDSVCGEVVMLREEIKRLEKDERAQKGTLSGEVMKLRQENSAQKDHLKQKDQEKIEVIRHLS...
AA_position 198
XM_017558171.1 - Vigna angularis (adzuki bean) - NCBI
Trichomonas vaginalis G3 ankyrin repeat protein, putative (TVAG_275690) partial mRNA. (1520 bp)
AA_position 132
XM_001314580.1 - Trichomonas vaginalis G3 - NCBI
PREDICTED: Vigna radiata var. radiata protein NETWORKED 4B (LOC106772009), mRNA. (2601 bp)
NETWORKED 4B" /protein_id="XP_014513597.1" /db_xref="GeneID:106772009" /translation="MMKNQPSQWWWLESHSNTRRSPWLQSTLTELNEKTKAILKLIEEDADSFAQRAEMYYKKRPQLVSMVEDFYRTHRSLAERYDQIAGIRQQKTGGSPFSPLKHHQPEKLMSFANDSYDSCSESCDVEESGESEIDDPEPEEEEDSKFDNCAELKEVQFVAANDVMEIERLGEENKDHKDQNKQKYNIYEVVMLREEIEQLRKENRVQKDELNRKSITFDELMMLREEIEQLRKENRAQKDELYQKDIICGEAMMLREEIEQLGKENRVLKDELSQKSIICGEVMILREEIEQFRKENRAQKHELNQKDIICGEAMMSREEIEQLSKENTVLKDELNQKNIICDEVMMLREEIEQLRKENREQKDELNQKDNICGEIMMLREEIEQLGKENGALKDELNKKYIICGEIMMLREEIEQLRKYNRGQRNELDQKGNKCEVTMLREEIEVYTKENRVKNDELNPEDSVCGEVVMLRKEIERLGKDERAQKGTLSGEVMKLRQENSAQKDHLKQKDQEKIE...
AA_position 207
XM_014658111.2 - Vigna radiata var. radiata (mung bean) - NCBI
PREDICTED: Xiphophorus hellerii gastrula zinc finger protein XlCGF8.2DB-like (LOC116731626), mRNA. (1000 bp)
and 88% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:116731626" CDS 38..1000 /gene="LOC116731626" /codon_start=1 /product="gastrula zinc finger protein XlCGF8.2DB-like" /protein_id="XP_032437333.1" /db_xref="GeneID:116731626" /translation="MMIHTGEKPFSCVNCGKRFSRKDELTKHMMIHTGEKPFSCVNCGKIFSQKQNLTKHMMIHTGEKPFSCVNCGKIFSQKQNLTKHMMIHTGEKPFSCVNCGKRFSRKDELTKHMMIHTGEKPFSCVNCGKRFSRKDELTKHMMIHTGEKPFSCVNCGKRFSRKDELTKHMMIHTGEKPFSCVNCGKSFSRKQHLTGHMRTHTGEKPFSCVTCGKSFSHKQNLTRHMMIHTVEKPFSCVNCGKGFSQKQELAQHMMIHTSEKPFSCGNCGKCFYRKQYLTQHMMIHTGEKPFLCVNCGKSFSRKQHLTQHMSVTLSIVEYQG"...
AA_position 22
XM_032581442.1 - Xiphophorus hellerii (green swordtail) - NCBI
PREDICTED: Papaver somniferum uncharacterized LOC113343944 (LOC113343944), mRNA. (1054 bp)
to: 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:113343944" CDS 16..627 /gene="LOC113343944" /codon_start=1 /product="uncharacterized protein LOC113343944" /protein_id="XP_026443814.1" /db_xref="GeneID:113343944" /translation="MQRKDKISVLQARNDELELKLHHTQVEKDELELKLHHARVEKDELELKLHHAQVEKDELVHHAQVEKDKLLFQIELLRKGKSWVEIDVVHGDETGAFQGDETDDVQGDEIDDVQGDEIDDDSFRSDEIDDEIDDDRGGDETGAVHGDETGAVQGDETGDVQGAEIDDDSLRSSKRQKRSPLVEKIITKRGRGRPPKPKKRSSS" ORIGIN //...
AA_position 28
XM_026588029.1 - Papaver somniferum (opium poppy) - NCBI
PREDICTED: Sebastes umbrosus CD209 antigen-like protein C (LOC119494693), transcript variant X1, mRNA. (2837 bp)
C-type lectin domain family 4 member M-like isoform X1" /protein_id="XP_037636693.1" /db_xref="GeneID:119494693" /translation="MQLMEVDDDELHVNKNLTMQGLLNSVDFQRKKQPSRCASVCLGLLCAVLLAGNIGQLVYYEIISRSASADPTQASYIQGGQEQSSYDALTAERKQLDARLTNLTKEKDLLQQSYSSVTTERDEFKASFNNLKNESDQLQVSYNTLKQESDQLQTNKDQLQTKYSSLQRQKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQREKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLLKQKDELQTLSVTLRANRDQLQSNYSSLKINKDQLQRSYNTLSLSKIFLQTRYNSLEKDKERLQSSYNTLQREKEQLQTKYTSLAAARDQLQKKIDKVRAKPCQTGWSKFDISCYFVSNLEKNWTQSRQYCIAEGADLVVIDSRDEQAFVNGLLDDGKNAWTGMTDSIIEGIWMWVDGTPVTTTYWGEDQPNSYDGNQDCGETVQKSLGVGEWNDDGCFGDQN...
AA_position 170
XM_037780765.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Spodoptera frugiperda zinc finger protein 184-like (LOC118280938), mRNA. (2255 bp)
codon_start=1 /product="zinc finger protein 184-like" /protein_id="XP_035457241.1" /db_xref="GeneID:118280938" /translation="MDDSPELELKKLCCTCLSRNRKLFQLCRLPDGINNLYSLLSYDSEAYREGFYRDTMSLYICWECRAVMCRITRFRLQACTALKHLSDIADGRTNVKSTCLSRLTSKKLNEIAVTSKCMNTENFINLTEDFIDCGPITDLLIKNEYDDDDIPLSELNNWSDNDPATIDCKDELSTTIANENELSKSIEHKDELSKSIDNKDELSNTIDNKDELSKSIDNKDELSKSIDNKDELSNNVLPGVKKKRKHVKKRFSIVSIDDSELEKMRSDCRMDAEYLAASFKCDSCIEIFNSEAEMNEHNSLHLEKPNHTHCDICLVYTPTSSYISHRQEHYLRRDCKLCKYTCLNEKAIYVHLETKHEIKEYSNKKTKTSKVALKEDSTTTKLKDSSLEYKCDECDQYFGNKSARWKHVQKCHREGFECATCGQRFPFKNNLRRHEQRHKSPPPREECEICHKMIRVSLKANHAKIHTERPRYRCE...
AA_position 169
XM_035601348.1 - Spodoptera frugiperda (fall armyworm) - NCBI
PREDICTED: Oryza sativa Japonica Group disease resistance protein PIK6-NP-like (LOC107281440), mRNA. (500 bp)
samples with support for all annotated introns" /db_xref="GeneID:107281440" CDS 168..467 /gene="LOC107281440" /codon_start=1 /product="disease resistance protein PIK6-NP-like" /protein_id="XP_015643813.1" /db_xref="GeneID:107281440" /translation="MAETVLSMARSLVGSAISKAASAAANETSLLLGVEKDIWYIKDELKTMQAFLRAAEVMKKKDELLKVWAEQIRDLSYDIEDSLMNLKSILKAKPYFVSW" misc_feature 243..>416 /gene="LOC107281440" /note="Coiled-coil domain of the potato virux X resistance protein and similar proteins; Region: RX-CC_like; cd14798" /db_xref="CDD:271353" ORIGIN //...
AA_position 42
XM_015788327.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
Mitosporidium daphniae uncharacterized protein (DI09_98p30), partial mRNA. (1083 bp)
protein_id="XP_013236407.1" /db_xref="GeneID:25261139" /translation="MFCLRNNYEIASFHASISSFLDQLVSLAASDDVLLSSKQNALSTFQKAILINGLLDRASIHDTCQLFSLVLFPLLRSISKCDGEKKQPDEEEIPFRIFSIISKLVLQCIPLLQKRDSEFVPQWQEYLRLLCEQYTLKDIVIEDEASSSFIIREAILELLKNLLLILKAAIDDTNVETEWAKFIWEDTWHVIGQVLPNLRSDLGVISEIGSPKFEHVKEENAENAEKDELAEKDELAEKDELAEKDELASCGEQENQHMSCPEKENQHPPGLEQGNQDTSCREQESEHQADQEKNNEHQTQPSTEAKELSNIESMATLVPEYRGKTPSEETPIIVGHSVPTEMTVIECEESNSLQSSSTAL" ORIGIN // REFERENCE 1 (bases 1 to 1083) AUTHORS Haag,K.L., James,T.Y., Pombert,J.F., Larsson,R., Schaer,T.M., Refardt,D. and Ebert,D. TITLE Evolution of a morphological...
AA_position 226
XM_013380953.1 - Mitosporidium daphniae - NCBI
PREDICTED: Poecilia reticulata C-type lectin domain family 4 member G-like (LOC103477754), mRNA. (1259 bp)
introns" /db_xref="GeneID:103477754" CDS 25..1167 /gene="LOC103477754" /codon_start=1 /product="C-type lectin domain family 4 member G-like" /protein_id="XP_008429274.1" /db_xref="GeneID:103477754" /translation="MKTANQQESIKTLITDRRQLIEEQKMMENEMEEVVRDRHLSLEKAGFIQKRLTQVREELNKERDELRNKIDELSREKDELSRKNDELSNEKDEPNDEKDELNKERDELSRKTEELSKERDELRNKINELSREKDELSRKNDELNNEKDELSRKTEELSKERDRLSEDKHELRQEKDKLNKEKKDLSTEKEELKKEREKLRVLTDQAEKRCRERDALKNFYDALMKFDNFPVRDLCPVSLRPKCQHCAKHEKSYKGHCYYIYPYDIGYANWDRSRQLCKTEGGDLVVIDDLEEQEFINNHTQKYDSDNHGYWIGLHHFRHNWSWVDGRRNFLEFWIEGIPRSSGAALHMPRQKATESWRAEDKMEASKFICERLEISWPFG" misc_...
AA_position 77
XM_008431052.2 - Poecilia reticulata (guppy) - NCBI
PREDICTED: Xiphophorus couchianus trichohyalin-like (LOC114141699), transcript variant X3, mRNA. (1998 bp)
GeneID:114141699" /translation="MENNRDEDSSTVNVNNAKRPLNTEEEMKSSALRLSSLLLVCFGLLCAILTAKFVYMSMMTANQMENIKTLATDKKRLIEERKMMKNQIEQVIRDRLLSLLRERLTRERLTQVSEELSNKIEELNRQTEELKKERDELSKEKEEVNKKKEEVNQDREELISNTQGLKKERDELNKEQVKQSKEKEKLKEEEEELSKEKKELSNEKEELSKRKEELKEKDERAGLIKEKDKLSKEKKELNTEKDKLKKKNDELSKEKEEIRKEKDELNKEKYKLSKDKEELSKEKDRLNKQKGDLNKMKAELIKKKEGLSEKTKELNKEINKLNKEKDELSKKTEELIKKKEQLNKEEDELKKEEDKLSKKKEELIKKIEELSKKIMELNKEKAGLSKEKDELSKQKAKLDKEKDELSKDKKKLSNEKDKLDKEKDELSKDKKKLSNEKDGLNKEEGDLNKMKVEQSQKKGELSKEKEELNKMAKELNKEKDDLSKKTAELTKKTEELNKLKVNMDKDLNENKLELNKEKEELNKLKVNLNKEKDELNKNKGKLNKEKEELNKKKVDLNKEKEELNKKKV...
AA_position 262
XM_028012414.1 - Xiphophorus couchianus (Monterrey platyfish) - NCBI
PREDICTED: Raphanus sativus FKBP12-interacting protein of 37 kDa-like (LOC108851773), mRNA. (1033 bp)
with support for all annotated introns" /db_xref="GeneID:108851773" CDS 97..843 /gene="LOC108851773" /codon_start=1 /product="FKBP12-interacting protein of 37 kDa-like" /protein_id="XP_018480742.1" /db_xref="GeneID:108851773" /translation="MDGDHSASNATRVSGNKRKFGDHEHDVSVSKKSCTECVAIVSSTIESLVVFKDELASIRTLLSGSFDKLKDELASLFFDSFQSVKDELASCQNELDKWKSAFKKESFVPARKSPEPQHVIDYIQTLRSSDKYLKEELEIAQMKLAIRDLKAQLKPESEKLTDGDTEVHDEQQQQGSTPSGPSRNVAYLEEELRAANARIAELNEYQEVELKEMVKQLEYYRNLGKLILDKFPDLVPPQPAPEDNNDQR" ORIGIN //...
AA_position 52
XM_018625240.1 - Raphanus sativus (radish) - NCBI
Wallemia mellicola CBS 633.66 hypothetical protein mRNA. (684 bp)
WALSEDRAFT_60048" /db_xref="GeneID:18473708" CDS 286..624 /locus_tag="WALSEDRAFT_60048" /note="hypothetical protein UM05520.1; expressed protein" /codon_start=1 /product="hypothetical protein" /protein_id="XP_006957643.1" /db_xref="GeneID:18473708" /db_xref="JGIDB:Walse1_60048" /translation="MKKIKDELNRKAYLEMVGSSLFPQDEQKRKRKSVYKETKDELQVITSVLFSMVAVATAIWWAGGTMNPTYKTLLAMFGAIAIAIVETALYVIIQMRKSETGRDTEERKKKSQ" misc_feature 286..561 /locus_tag="WALSEDRAFT_60048" /note="Endoplasmic reticulum-based factor for assembly of V-ATPase; Region: Vma12; pfam11712" /db_xref="CDD:288549" ORIGIN // REFERENCE 1...
AA_position 5
XM_006957581.1 - Wallemia mellicola CBS 633.66 - NCBI
PREDICTED: Xiphophorus maculatus myb-like protein X (LOC111608070), mRNA. (1332 bp)
by RNAseq alignments" /db_xref="GeneID:111608070" CDS 67..1248 /gene="LOC111608070" /codon_start=1 /product="myb-like protein X" /protein_id="XP_023186244.1" /db_xref="GeneID:111608070" /translation="MMTTNQLENIKTLTTDKKRLIEERKMMENQIEEVIRDRHLSVVRAGLTRERLTQEREELNKEREELRKKIDELSLEKEELSKKIDDLNNEKDELNKEKDELSKKTAELSSKTEELNKEKAELSKNTKDLNKKKLELNKEKDKLSEDKKEQSQEKEKLNKEKDELSKDKKELSNEKEKLNKEKDELSKEKKYLSTEKEELKKDKAELNKEREKLRVLTDEAENRCKNRDALKKFFNHVMRFRTFPVSEMCPLYMRTKCPACREKEPLYKGHCYWIYPYDIGLLTWYQGDIWCFDDGGSLVVIDDLEEQEFINNHTKRYKGDHGYWIGLRNVRNKWLWVDERRNTLDFWIKGIPHTSGAALHMSERKATESWRAEDIQRDNKIICERPMIVWPYN" misc_...
AA_position 91
XM_023330476.1 - Xiphophorus maculatus (southern platyfish) - NCBI
PREDICTED: Xiphophorus maculatus C-type lectin domain family 4 member M-like (LOC102236912), mRNA. (2735 bp)
db_xref="GeneID:102236912" CDS 81..1271 /gene="LOC102236912" /codon_start=1 /product="C-type lectin domain family 4 member M-like" /protein_id="XP_023187127.1" /db_xref="GeneID:102236912" /translation="MHVMTAKQQESIKNLTTERRQLIEERKMKENQIEEVIRDRHLSAVRAGLNPQRLTQEREELNKEREELRKKIDELSLEKEELSKKIDDLNNEKDELNKEKDELSKKTAELSSKTEELNKEKAELSKNTKDLNKKKLELNKEKDKLSEDKKEQSQEKEKLNKEKDELSKDKKELSNEKEKLNKEKDELSKEKKYLSTEKEELKKDKAELNKEREKLRVLTDEAENRCKNRDALKNFYDALMKFDNFPVHDLCPVWLRPKCHHCTKHEKSYKGHCYYIYPYDIGYANWDRSRQLCKIEGGDLVVIDDLEEQEFINNHTKQYDSDNHGYWIGLRHFRRNWSWVDGRRNFLEFWIKGIPHSSGAALHMPRKKATESWKAEDKLEAYKFICERLEISWPFS"...
AA_position 93
XM_023331359.1 - Xiphophorus maculatus (southern platyfish) - NCBI
PREDICTED: Vigna unguiculata protein NETWORKED 4B-like (LOC114191805), transcript variant X2, mRNA. (2317 bp)
NETWORKED 4B-like" /protein_id="XP_027937009.1" /db_xref="GeneID:114191805" /translation="MMKNQPSQWWWLESHSNTKLSPWLQSTLTELNEKTKAMLKLIEEDADSFAQRAEMYYKKRPQLVSLVEDFYRTHRSLAERYDQVAGIRQQKTGGSPFSPLKHHQPEKLMSFANDSYDSYSESCDVEESGESEIDDPEQEEEEDSKIDNCVELDGVQFVAANDVMEIERLGEENKDHKDLNKQKYNIYEAVMLWEEIEQLRKESRVQKDELNRKSIVFGELMILKEEIEQLSRENRAQKDELNQKAIICGEAMMLREEIEQLSKENRVLKDELSQKSIICDEVMMLREEIEQIRKENRAQKEELNQKDVICGEAIMSREEIEKLSKENRVLKDELNQKSILCGEVMMLREEIAQLRKENRAQKDELNQKDNSCSEIMMLREEIEQLGKENGGLKDELKKKDNICGEIMMLREEIEQLGKENGALRDELKKDNICDEIMMLREEIEQMGKENGALKNELNKKDNICGEIMMLREEIEQLGKENGALKVELNKKYIICGEIMMLREEIEQLRK...
AA_position 207
XM_028081208.1 - Vigna unguiculata (cowpea) - NCBI
PREDICTED: Vigna unguiculata protein NETWORKED 4B-like (LOC114191805), transcript variant X1, mRNA. (2376 bp)
NETWORKED 4B-like" /protein_id="XP_027937008.1" /db_xref="GeneID:114191805" /translation="MMKNQPSQWWWLESHSNTKLSPWLQSTLTELNEKTKAMLKLIEEDADSFAQRAEMYYKKRPQLVSLVEDFYRTHRSLAERYDQVAGIRQQKTGGSPFSPLKHHQPEKLMSFANDSYDSYSESCDVEESGESEIDDPEQEEEEDSKIDNCVELDGVQFVAANDVMEIERLGEENKDHKDLNKQKYNIYEAVMLWEEIEQLRKESRVQKDELNRKSIVFGELMILKEEIEQLSRENRAQKDELNQKAIICGEAMMLREEIEQLSKENRVLKDELSQKSIICDEVMMLREEIEQIRKENRAQKEELNQKDVICGEAIMSREEIEKLSKENRVLKDELNQKSILCGEVMMLREEIAQLRKENRAQKDELNQKDNSCSEIMMLREEIEQLGKENGGLKDELKKKDNICGEIMMLREEIEQLGKENGALRDELKKDNICDEIMMLREEIEQMGKENGALKNELNKKDNICGEIMMLREEIEQLGKENGALKVELNKKYIICGEIMMLREEIEQLRK...
AA_position 207
XM_028081207.1 - Vigna unguiculata (cowpea) - NCBI
PREDICTED: Acropora digitifera myosin-11-like (LOC107337720), mRNA. (1665 bp)
myosin-11-like" /protein_id="XP_015758433.1" /db_xref="GeneID:107337720" /translation="MSRSTPGNQHYSLMLHWFKMSATLKVCSFFMRHKSTIGKSERCVEVQTTFEAHRDFELGTPVEFPVSGGHPRFGVIRWIGNIPQEKDHLIVGLELEQKTSAFCDGTLNGTRYFTCEPGRGFFCILESCRKDSRQTSNSQNNDNILPGKDEQCEENAFSRQLASLDSSSYQQALEDIQQLINENNKLNLEKCQWEKEKNDVQQEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRAKETQVHELETSLTTAQQALENMQQLEIRHKGLKLEKCQLEKEKNVVQQEKDELVVQNNSLQTDLRAKETQVDVYSFGVLFCEMCIREMPDPQRRH...
AA_position 204
XM_015902947.1 - Acropora digitifera - NCBI
PREDICTED: Sebastes umbrosus CD209 antigen-like protein C (LOC119494690), transcript variant X3, mRNA. (5616 bp)
centromere-associated protein E-like isoform X3" /protein_id="XP_037636681.1" /db_xref="GeneID:119494690" /translation="MELMEVDDDELHVNKNLTMGGLVTSVDFQRKKKPSRCASVCLGLLCAVLLAGNIGQFVYYEIISRFSSADPTQASYIQGGQLQSSYDALTAERKQLDARLTNLTKEKDLWQQSYSSLTTERDEFKASFNNLKNESDQLQVSYNTLKLESDQLQTYHTNLTASKDQLQTMYSSLQREKDELQTNKDQLQTKHSSLQREKDELQTNKDQLQTKHSSLQREKDELQTNKDQLQTSYSSLQREKEELQTLSVTLRANRDQLQSNYSSLKTNKDQLQRSYDTLSISRNHIQTSYNSLQKDKERLQSSYNTMQKEKEQLQKSYSSLTTERDDFKASFNNLKNESDQLQVSYNTLKLESDQLQTYHTNLTASKDQLQTKHSSLQREKDELQTNKDQLQTKYSSLQRQKDELQTLSVMLRANRDQLQSNYSSLKMNKDQLQRSYNTLNMSRNLIQTSYNSLQKDKERLQSSYNSLQKEKEQLQQSYSS...
AA_position 177
XM_037780753.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Drosophila persimilis putative leucine-rich repeat-containing protein DDB_G0290503 (LOC6593906), mRNA. (3016 bp)
QYKEKGFGDLHDSFFIGRKNLYLMTREMPHEVFVMLKFLDGSIEVYKGTKVYMGDEEEDYVIKSFNTIPRIGDYSVQQTATSVSLDALFRKQFLPFDDLPEWKELTIMIRETLNIKVYSQNMLNIFIIVLVFFNLSENLTRGSDFHENQESCFVSRELEDQCAAVCYPTVKPLLKYMGICHQKDLHISGMQNQLQDQNEKVTKYKTQVEFLNKKLVDERSSSGLKNDLKETIDKVQNLRLELSEELKKLYRQKNNTVKNQHEEIANVKMQLKRKDEQNEKTMIEKDEIIKQKEKTMEEKDELLKQKKKIMEEKDELLKKKDNTLKNLQEEIANVKMQLKRKDEQNEKTMIEKDEIIKQKEKTMEEKDELLKQKKKIMEEKDELLKKKDNTLKNLQEEIANVKMQLKRKDEQNEKTMIEKDEIIKQKEKTMEEKDELLKQKKKIMEEKDELLKKKDNTLKNLQEEIANVKMQLKRKDEQNEKTMIEKDEIIKQKDKTMEEKDELLKKKDSTLKNLQKEIANVKIQLTSKDELLEQKEEQIKKKDQFIRHILDNADPKISETHTIDVPLAEPDESGWTIILQELEGLASLEKKLAQYKEKPF...
AA_position 555
XM_026987349.1 - Drosophila persimilis - NCBI
PREDICTED: Ceratosolen solmsi marchali homeobox protein E60-like (LOC105366778), transcript variant X1, mRNA. (714 bp)
by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:105366778" CDS 46..420 /gene="LOC105366778" /codon_start=1 /product="homeobox protein E60-like isoform X1" /protein_id="XP_011503627.1" /db_xref="GeneID:105366778" /translation="MLFGERPRTRRTKVKDELIRTAVPEEKRPRTAFSIEQLARLKREFAENKYLTEQRRQALSKELGLNEAQIKIWFQNKRAKIKKASGQKNPLALQLMAQGLYNHSTVPLSKDELEQAAELQANGI" misc_feature order(124..138,142..144,193..195,211..213,250..252, 256..261,268..273,277..285,289..294) /gene="LOC105366778" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_...
AA_position 15
XM_011505325.1 - Ceratosolen solmsi marchali - NCBI
PREDICTED: Helianthus annuus uncharacterized LOC118483133 (LOC118483133), mRNA. (382 bp)
including 8 samples with support for all annotated introns" /db_xref="GeneID:118483133" CDS 25..363 /gene="LOC118483133" /codon_start=1 /product="uncharacterized protein LOC118483133" /protein_id="XP_035834566.1" /db_xref="GeneID:118483133" /translation="MRSLTIFLFLFSLILIASLCDARADPDNYWKIVMKDELMPTTQDAQSQDTQRSSGADNYWKIVMKDELMPTTNQDAQSQDTQRSSSADNYWKIVMKDEIMSTTIQDAPKPPK" misc_feature 97..>192 /gene="LOC118483133" /note="Organ specific protein; Region: Organ_specific; pfam10950" /db_xref="CDD:402502" ORIGIN //...
AA_position 35
XM_035978673.1 - Helianthus annuus (common sunflower) - NCBI
Wickerhamomyces ciferrii putative threonine-rich GPI-anchored glycoprotein partial mRNA. (2163 bp)
DIVSDGIKLEISDKDHEETDAETVRPDDERSWLKELVSEDELNKLNDDDKLASDDELACDIELASDDKLESVDRLESVDELASDDKLDFVDSVDELASDSELASVERLASDDELESGDELESDDEIASDDELAPDDELASDDKLASVERLASDDELESGDELELDDEIASDDELAPDDELASDDKLASDDELASDDELASDDELKSEDELASGNELDSDDELESDNKLELATDSVLDSDDEIASDDELNSDDELESGNEPDSDDKLASDDELAFDDELASDDELNSDDDLASDESQEFKDELELASDDKLASADELESEDKLESDEKLGSKDELASDNELNSDDGLASDDELASDDELASDDELKSEDELESGNELDSDDELESDDKLELAPDSVLDPDDEIASDDELNSDDELASDDELAPDDELTSDDKLASDDELASDDELKSEDELASGNELDSDNDLESDNKLELAPDSALDSGDKLELASDDKSGNELDSDDELASDDKVESKDELELASGDKLESKDELASDDELAPDDELASDLAPDDEIASDDELASDDELKSEDELESGNELDSDDELESDDKLELAPDSVLDPDDEIAS...
AA_position 311
XM_011275888.1 - Wickerhamomyces ciferrii - NCBI
PREDICTED: Musca domestica uncharacterized LOC105262538 (LOC105262538), mRNA. (596 bp)
samples with support for all annotated introns" /db_xref="GeneID:105262538" CDS 45..440 /gene="LOC105262538" /codon_start=1 /product="uncharacterized protein LOC105262538" /protein_id="XP_011296130.1" /db_xref="GeneID:105262538" /translation="MKFYITVAYVIIASTAFANADLFADTHKLIDLVIDDEATHIDSTCFNQIKDELMKELEIASAMYIDRVENGMPVFKEGVHLNMESFIEDTLLPKALVTASDDCLHSVKDELKAFAKARFGAAVKTIDPDFL" ORIGIN //...
AA_position 50
XM_011297828.2 - Musca domestica (house fly) - NCBI
PREDICTED: Musca domestica uncharacterized LOC105262537 (LOC105262537), mRNA. (506 bp)
samples with support for all annotated introns" /db_xref="GeneID:105262537" CDS 57..458 /gene="LOC105262537" /codon_start=1 /product="uncharacterized protein LOC105262537" /protein_id="XP_011296129.1" /db_xref="GeneID:105262537" /translation="MKFQIAVLFGVIFSAGFVSAGLFEDTHKLIDLVINDEADHIDSKCFSQIKDELIKELEVAAATYIDRVENGMPVFKSGVHLDMEDFIENTLLPSALVSASDDCLHTVKDELRAFLKSRFGPSFKTLDPNFYKN" ORIGIN //...
AA_position 50
XM_011297827.2 - Musca domestica (house fly) - NCBI
PREDICTED: Anoplophora glabripennis transcription factor MafK (LOC108906600), mRNA. (772 bp)
support for all annotated introns" /db_xref="GeneID:108906600" CDS 157..555 /gene="LOC108906600" /codon_start=1 /product="transcription factor MafK" /protein_id="XP_018565421.1" /db_xref="GeneID:108906600" /translation="MPQESKKNAKLAPLSPSPLLDISDDELVSISVRDLNRQLKLRGLSRDEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETEKTQEWRDLEVMKDELIHMREEMSGMTSRYEALKQFAISNKIPIPPDLEHF" misc_feature 292..498 /gene="LOC108906600" /note="Basic leucine zipper (bZIP) domain of small musculoaponeurotic fibrosarcoma (Maf) proteins: a DNA-binding and dimerization domain; Region: bZIP_Maf_small; cd14717" /db_xref="CDD:269865" misc_...
AA_position 76
XM_018709905.1 - Anoplophora glabripennis (Asian longhorned beetle) - NCBI
PREDICTED: Ceratosolen solmsi marchali homeobox protein E60-like (LOC105366778), transcript variant X2, mRNA. (1053 bp)
alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:105366778" CDS 340..759 /gene="LOC105366778" /codon_start=1 /product="homeobox protein E60-like isoform X2" /protein_id="XP_011503628.1" /db_xref="GeneID:105366778" /translation="MQWPAWVYCTRYSDRPSSGRSPRTRRTKVKDELIRTAVPEEKRPRTAFSIEQLARLKREFAENKYLTEQRRQALSKELGLNEAQIKIWFQNKRAKIKKASGQKNPLALQLMAQGLYNHSTVPLSKDELEQAAELQANGI" misc_feature order(463..477,481..483,532..534,550..552,589..591, 595..600,607..612,616..624,628..633) /gene="LOC105366778" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039"...
AA_position 30
XM_011505326.1 - Ceratosolen solmsi marchali - NCBI
PREDICTED: Sebastes umbrosus CD209 antigen-like protein C (LOC119494690), transcript variant X2, mRNA. (5952 bp)
centromere-associated protein E-like isoform X2" /protein_id="XP_037636680.1" /db_xref="GeneID:119494690" /translation="MELMEVDDDELHVNKNLTMGGLVTSVDFQRKKKPSRCASVCLGLLCAVLLAGNIGQFVYYEIISRFSSADPTQASYIQGGQLQSSYDALTAERKQLDARLTNLTKEKDLWQQSYSSLTTERDEFKASFNNLKNESDQLQVSYNTLKLESDQLQTYHTNLTASKDQLQTMYSSLQREKDELQTNKDQLQTKHSSLQREKDELQTNKDQLQTKHSSLQREKDELQTNKDQLQTSYSSLQREKEELQTLSVTLRANRDQLQSNYSSLKTNKDQLQRSYDTLSISRNHIQTSYNSLQKDKERLQSSYNTMQKEKEQLQKSYSSLTTERDDFKASFNNLKNESDQLQVSYNTLKLESDQLQTYHTNLTASKDQLQTKHSSLQREKDELQTLSVTLRANRDQLQSNYSSLKTNKDQLQRSYDTLSISKNHIQTSYNSLQKDKERLQSSYNTLQKEKEQLQQSYSSLTTERDDFKTSSNNLKNERNQ...
AA_position 177
XM_037780752.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Sebastes umbrosus CD209 antigen-like protein C (LOC119494690), transcript variant X1, mRNA. (5952 bp)
centromere-associated protein E-like isoform X1" /protein_id="XP_037636679.1" /db_xref="GeneID:119494690" /translation="MELMEVDDDELHVNKNLTMGGLVTSVDFQRKKKPSRCASVCLGLLCAVLLAGNIGQFVYYEIISRFSSADPTQASYIQGGQLQSSYDALTAERKQLDARLTNLTKEKDLWQQSYSSLTTERDEFKASFNNLKNESDQLQVSYNTLKLESDQLQTYHTNLTASKDQLQTMYSSLQREKDELQTNKDQLQTKHSSLQREKDELQTNKDQLQTKHSSLQREKDELQTNKDQLQTSYSSLQREKEELQTLSVTLRANRDQLQSNYSSLKTNKDQLQRSYDTLSISRNHIQTSYNSLQKDKERLQSSYNTMQKEKEQLQKSYSSLTTERDDFKASFNNLKNESDQLQVSYNTLKLESDQLQTYHTNLTASKDQLQTKHSSLQREKDELQTLSVTLRANRDQLQSNYSSLKTNKDQLQRSYDTLSISKNHIQTSYNSLQKDKERLQSSYNTLQKEKEQLQQSYSSLTTERDDFKTSSNNLKNERNQ...
AA_position 177
XM_037780751.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Xenopus tropicalis titin homolog (LOC101735255), transcript variant X4, mRNA. (5024 bp)
alignments, including 11 samples with support for all annotated introns" /db_xref="GeneID:101735255" CDS 224..2956 /gene="LOC101735255" /codon_start=1 /product="myb-like protein X isoform X4" /protein_id="XP_031758241.1" /db_xref="GeneID:101735255" /translation="MAKQSIDSKDDAKEKKNKLKEKIGEVLEKKDELKEKKDELKEKRDELKEKIGELKEKNDELKEKKDKLKEKKGELKEEEDLKEKIEDIMLGKVDDINNSIGEIKVQKHDIMEKKDELKEKKDELKEEEDLKEKIEDIMLGKVDDINNSIGEIKVQKHDIMEKKDELKEEKKEQKEKTENIIVNNKKQIDDMMKKKDKLKEEKKVQKAKTENIIEKRDDIVNNKEQIDDIMKKKDELKEEEKEQKGKTENVIEKRDDIVNNKEQIDDIMKKKDELKEEEKEQKEKTENVIEKSDDIVNNKEQIGDIRGNEDELKTSVEETGSDCIHDPAELTLTTESM...
AA_position 30
XM_031902381.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Xenopus tropicalis titin homolog (LOC101735255), transcript variant X3, mRNA. (5023 bp)
by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:101735255" CDS 223..2955 /gene="LOC101735255" /codon_start=1 /product="titin homolog isoform X3" /protein_id="XP_031758240.1" /db_xref="GeneID:101735255" /translation="MAKQSIDSKDDAKEKKNKLKEKIGEVLEKKDELKEKKDELKEKRDELKEKIGELKEKNDELKEKKDKLKEKKGELKEEEDLKEKIEDIMLGKVDDINNSIGEIKVQKHDIMEKKDELKEKKDELKEEEDLKEKIEDIMLGKVDDINNSIGEIKVQKHDIMEKKDELKEEKKEQKEKTENIIVNNKKQIDDMMKKKDKLKEEKKVQKAKTENIIEKRDDIVNNKEQIDDIMKKKDELKEEEKEQKGKTENVIEKRDDIVNNKEQIDDIMKKKDELKEEEKEQKEKTENVIEKSDDIVNNKEQIGDIRGNEDELKTSVEETGDVSIEETGKDVSD...
AA_position 30
XM_031902380.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Xenopus tropicalis titin homolog (LOC101735255), transcript variant X2, mRNA. (5026 bp)
by RNAseq alignments, including 10 samples with support for all annotated introns" /db_xref="GeneID:101735255" CDS 223..2958 /gene="LOC101735255" /codon_start=1 /product="titin homolog isoform X2" /protein_id="XP_031758239.1" /db_xref="GeneID:101735255" /translation="MAKQSIDSKDDAKEKKNKLKEKIGEVLEKKDELKEKKDELKEKRDELKEKIGELKEKNDELKEKKDKLKEKKGELKEEEDLKEKIEDIMLGKVDDINNSIGEIKVQKHDIMEKKDELKEKKDELKEEEDLKEKIEDIMLGKVDDINNSIGEIKVQKHDIMEKKDELKEEKKEQKEKTENIIVNNKKQIDDMMKKKDKLKEEKKVQKAKTENIIEKRDDIVNNKEQIDDIMKKKDELKEEEKEQKGKTENVIEKRDDIVNNKEQIDDIMKKKDELKEEEKEQKEKTENVIEKSDDIVNNKEQIGDIRGNEDELKTSVEETGDVSIEETGKDVS...
AA_position 30
XM_031902379.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Limulus polyphemus dysbindin-like (LOC106464943), transcript variant X1, mRNA. (1927 bp)
xref="GeneID:106464943" /translation="MMFENLKDKIINVQHDLTSSLRNLTVGDPKNFKTHVRGKKGASLNAGADLLHYYKSQWEELHRTSEENAEAAEDVAYRISDLNKFCRQEQDLMKQFNYQLSLAPGLHSSVMNLMGRIGELQGLFEEVESSLLNLENVLETQALQEKQLDHRFQLALYKEKKLAAFEELKVKLAQEHSKKVQEFEMRQQKVLKERQEAFREAFEEEMQHYKIHGRVERLSSTGSAGHPFGLEDVELENNEVDQSALDAFLAEELSPGSKDELDTDKDELDTDKDELDTVKDDLDKRNKDHDNQTVTR" ORIGIN //...
AA_position 258
XM_013925116.2 - Limulus polyphemus (Atlantic horseshoe crab) - NCBI
PREDICTED: Octopus bimaculoides uncharacterized LOC106880222 (LOC106880222), mRNA. (444 bp)
similarity to: 2 Proteins" /db_xref="GeneID:106880222" CDS 1..444 /gene="LOC106880222" /codon_start=1 /product="uncharacterized protein LOC106880222" /protein_id="XP_014785574.1" /db_xref="GeneID:106880222" /translation="MPFDSKGATIFHILKSFLSERSIPLIKKLSDLIKLFQENRKTLVDCKSFITHVILKMVLYKTNISKCQFPQLDFLKDELKDELDLTTYRMVEQFQDVIVLNIPNWYSNPFGVDAVDCEDDVHQELIELQNDNDATMRCRRNGKGGLW" ORIGIN //...
AA_position 76
XM_014930088.1 - Octopus bimaculoides - NCBI
PREDICTED: Lates calcarifer trichohyalin-like (LOC108877600), transcript variant X2, mRNA. (1314 bp)
includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:108877600" CDS 318..1226 /gene="LOC108877600" /codon_start=1 /product="trichohyalin-like isoform X2" /protein_id="XP_018523204.1" /db_xref="GeneID:108877600" /translation="MERKHREELKEKDELLNREVNKRRARTQAYVNCLDLLNRQEKALKSAELRGKALESNLRWELTLKEEKHQEEKKYKEEVEEETKRSEDGWRRMESHLREELNHKDELLKKETKKRKARTQAYVDCMNLLSQKEKDLKESEEQTHDALEKSLKLELALKDQREQEDKYKEKVEEETKRAEDELRRIESQLRQELKEKDELLETGIKKRKACTKAYLDCLVLLSQKEKELQEREEQRRNALEKSLRLELALKQQREQEENKSQEKMENQHDEKTEEETERSEAKEMNEKKEKPKKKRGKKKNRG" ORIGIN //...
AA_position 12
XM_018667688.1 - Lates calcarifer (barramundi perch) - NCBI
PREDICTED: Acyrthosiphon pisum uncharacterized LOC115033327 (LOC115033327), mRNA. (575 bp)
samples with support for all annotated introns" /db_xref="GeneID:115033327" CDS 35..448 /gene="LOC115033327" /codon_start=1 /product="uncharacterized protein LOC115033327" /protein_id="XP_029341535.1" /db_xref="GeneID:115033327" /translation="MEQNYEDSTKDKAIMNVDKFYGDTLFENYQDLNKNKTRNSNSNKDELTGRIPIASALGGDTLVKKKKKKKKEDKHMEQNYEDSTKDKAIMNVDKFYGDTLFENYHDLNKEETRDSNSNKDELTGRIPIASASEGDTL" ORIGIN //...
AA_position 44
XM_029485675.1 - Acyrthosiphon pisum (pea aphid) - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/aa%3aKDEL
lang : ja | div : | spe : | query_string : aa:KDEL | format : html | download :

0.000 | 0.000 | search_start;
0.462 | 0.462 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=(aa:KDEL)?to=0&format=json
0.537 | 0.075 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=(aa:KDEL)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.543 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]