GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2021-10-29 02:33:37, GGRNA : RefSeq release 207 (Jul, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1770 bp)
LOCUS NM_006562 1770 bp mRNA linear PRI 05-JUL-2021 DEFINITION Homo sapiens ladybird homeobox 1 (LBX1), mRNA. ACCESSION NM_006562 VERSION NM_006562.5 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL135794.19. On Sep 30, 2020 this sequence version replaced NM_006562.4. Summary: This gene and...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Xenopus laevis pituitary homeobox 3-like [provisional] L homeolog (homeobox100496651-provisional.L), mRNA. (1350 bp)
LOCUS XM_018225529 1350 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis pituitary homeobox 3-like [provisional] L homeolog (homeobox100496651-provisional.L), mRNA. ACCESSION XM_018225529 VERSION XM_018225529.2 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_018225529.2 - Xenopus laevis (African clawed frog) - NCBI
Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 18-JUN-2021 DEFINITION Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript...
Synonym: GRMZM2G136369; homeobox1; hox1a; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Strongylocentrotus purpuratus homeobox (H-6 family) (HMX), mRNA. (1402 bp)
ECO:0000256|SAM:MobiDB-lite" misc_feature 722..898 /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="propagated from UniProtKB/Swiss-Prot (Q26656.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(881..895,899..901,950..952,968..970,1007..1009, 1013..1018,1025..1030,1034..1042,1046..1051) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 887..1048 /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order...
Synonym: homeobox; SpHmx
NM_214561.2 - Strongylocentrotus purpuratus (purple sea urchin) - NCBI
Zea mays homeobox 3 (LOC542440), mRNA. (5334 bp)
LOCUS NM_001309211 5334 bp mRNA linear PLN 30-APR-2021 DEFINITION Zea mays homeobox 3 (LOC542440), mRNA. ACCESSION NM_001309211 XM_008675214 VERSION NM_001309211.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CABHLF012.1. On May 21, 2015 this sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a; hox3
NM_001309211.1 - Zea mays - NCBI
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 21-JUN-2021 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
misc_feature 341..523 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN // REFERENCE 1 (bases 1 to 1963) AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D., Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V., Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L., Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L., Tallon,L.J., Gill,J.E., Adams,M.D...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
2; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="propagated from UniProtKB/Swiss-Prot (Q804R0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..858 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
ynonym="homeobox; msh; msh-; msh-C; mshC; msx; msx-; msx-c; msxc; zgc:86596" /note="propagated from UniProtKB/Swiss-Prot (Q01703.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh; msh-; msh-C; mshC; msx; msx-; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh; msh-; msh-C; mshC; msx; msx-; msx-c; msxc; zgc:86596" /note="Homeobox domain...
Synonym: homeobox; msh; msh-; msh-C; mshC; msx; msx-; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Zea mays HOX1B protein (LOC732843), mRNA. (2974 bp)
c 1346-2098 EB403344.1 1-753 2099-2974 CABHLF019.1 113510775-113511650 c FEATURES Location/Qualifiers source 1..2974 /organism="Zea mays" /mol_type="mRNA" /cultivar="B73" /db_xref="taxon:4577" /chromosome="6" /map="6" gene 1..2974 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /note="HOX1B protein" /db_xref="GeneID:732843" exon 1..127 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /inference="alignment:Splign:2.1.0" exon 128..714 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /inference="alignment:Splign:2.1.0" misc_feature 242..244 /...
Synonym: GRMZM2G094935; homeobox2; Hox1b
NM_001112448.2 - Zea mays - NCBI
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
Synonym: ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. (1394 bp)
gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 702..854 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 858..989 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8
NM_130055.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (1018 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /inference="Similar to RNA sequence, EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1, INSD:DR751539.1" /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1" /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS IN: sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_126204.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 502..>822 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="Homeobox protein; Region: Abdominal-A; cl27820" /db_xref="CDD:332641" misc_feature 568..585 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="propagated from UniProtKB/Swiss-Prot (Q6B3N0.1); Region: Antp-type hexapeptide" misc_feature 625..804 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="...
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
LOCUS NM_204990 886 bp mRNA linear VRT 19-JUN-2021 DEFINITION Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. ACCESSION NM_204990 VERSION NM_204990.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(182..184,191..193,311..313,320..325,332..334) /gene="MIXL1" /gene_synonym="...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..379 /gene="MSX2" /inference="alignment:Splign:2.1.0" exon 380..804 /gene="MSX2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (2359 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..2359 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..2359 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" CDS 1..642 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_001335062.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. (1058 bp)
INSD:DR750746.1,INSD:DR750857.1,INSD:DR750745.1" /inference="similar to RNA sequence, mRNA:INSD:BT031362.1,INSD:BT031368.1" /note="homeobox protein 21 (HB21); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Helix-turn-helix motif, lambda...
Synonym: ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2
NM_127411.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus homeobox B5 (HOXB5), mRNA. (1453 bp)
synonym="Ghox-2.1; Hoxb-5" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..798 /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Ghox-2.1; Hoxb-5
NM_001025355.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 20-JUN-2021 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 619..729 /gene="HOXD8" /note="propagated from UniProtKB/Swiss-Prot (P23459.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" ORIGIN // REFERENCE 1 (bases 1 to 1263) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed chicken monoblastic leukaemia cells JOURNAL Leukemia...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D12 (HOXD12), mRNA. (1419 bp)
LOCUS NM_205249 1419 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 676..837 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(676..678,685..687,805..807,814..819,826..828) /gene="HOXD12" /note="specific DNA base...
NM_205249.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (927 bp)
LOCUS NM_001007985 927 bp mRNA linear VRT 19-JUN-2021 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.1 - Gallus gallus (chicken) - NCBI - UCSC
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1308 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(270..272,279..281,399..401,408..413,420..422) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 279..431 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6
NM_001036473.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (794 bp)
feature 58..60 /gene="Rhox5" /gene_synonym="Pem" /note="upstream in-frame stop codon" exon 94..175 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" CDS 97..723 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.2" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus msh homeobox 2 (MSX2), mRNA. (1107 bp)
LOCUS NM_204559 1107 bp mRNA linear VRT 18-JUN-2021 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 510..674 /gene="MSX2" /gene_synonym="HOX-8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(510..512,519..521,639..641,648..653,660..662) /gene="MSX2" /gene_synonym="...
Synonym: HOX-8; Msx-2
NM_204559.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 10 (WOX10), partial mRNA. (594 bp)
db_xref="TAIR:AT1G20710" CDS 1..594 /gene="WOX10" /locus_tag="AT1G20710" /gene_synonym="F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B" /note="WUSCHEL related homeobox 10 (WOX10); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is:...
Synonym: F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B
NM_101923.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. (1891 bp)
LOCUS NM_001005427 1891 bp mRNA linear VRT 26-APR-2021 DEFINITION Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_001005427 XM_418692 VERSION NM_001005427.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...MEOX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 605..763 /gene="MEOX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 552..724 /gene="MEOX2" /inference="alignment:Splign:2.1.0" exon 725..1891 /gene="...
NM_001005427.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D13 (HOXD13), mRNA. (1964 bp)
LOCUS NM_205434 1964 bp mRNA linear VRT 20-JUN-2021 DEFINITION Gallus gallus homeobox D13 (HOXD13), mRNA. ACCESSION NM_205434 XM_429309 VERSION NM_205434.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 719..880 /gene="HOXD13" /gene_synonym="chox-4.8; chox-4G" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(719..721,728..730,848..850,857..862,869..871) /gene="HOXD13" /gene_...
Synonym: chox-4.8; chox-4G
NM_205434.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (826 bp)
xref="GeneID:838660" /db_xref="TAIR:AT1G20700" CDS 1..636 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /inference="Similar to RNA sequence, EST:INSD:DR751559.1,INSD:AA585837.1,INSD:T22843.1, INSD:DR751560.1" /inference="similar to RNA sequence, mRNA:INSD:AJ441297.1" /note="WUSCHEL related homeobox 14 (WOX14); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: WUSCHEL...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_101922.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. (894 bp)
LOCUS NM_205015 894 bp mRNA linear VRT 20-JUN-2021 DEFINITION Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. ACCESSION NM_205015 XM_429269 VERSION NM_205015.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...TLX-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 511..672 /gene="TLX1" /gene_synonym="TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="TLX1" /gene_synonym="...
Synonym: TLX-1
NM_205015.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (1453 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 524..669 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" exon 670..1445 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1453) AUTHORS Joshi P, Darr AJ and Skromne I. TITLE CDX4 regulates the progression of neural maturation in the spinal cord JOURNAL Dev Biol 449 (2), 132-142 (2019) PUBMED 30825428 REMARK GeneRIF: Results show that in the spinal cord, caudal type homeobox 4 (CDX4) is...
Synonym: cCdx-B; CDXB; CHOX-CAD2; ox-cad2
NM_204614.1 - Gallus gallus (chicken) - NCBI - UCSC
Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. (555 bp)
LOCUS NM_001081487 555 bp mRNA linear PRI 20-JUN-2021 DEFINITION Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. ACCESSION NM_001081487 XM_001136381 XM_524055 VERSION NM_001081487.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 91..249 /gene="RAX2" /gene_synonym="RAXL1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" exon 1..216 /gene="RAX2" /gene_synonym="RAXL1" /inference="alignment:Splign:2.1.0" exon...
Synonym: RAXL1
NM_001081487.1 - Pan troglodytes (chimpanzee) - NCBI
Arabidopsis thaliana homeobox-leucine zipper protein 3 (HAT3), mRNA. (1447 bp)
misc_feature 346..645 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="HD-ZIP protein N-terminus; Region: HD-ZIP_N; pfam04618" /db_xref="CDD:398351" misc_feature 784..936 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 940..1071 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="homeobox associated leucin zipper; Region: HALZ;...
Synonym: HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3
NM_115903.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Pan troglodytes homeobox D4 (HOXD4), mRNA. (768 bp)
LOCUS NM_001081569 768 bp mRNA linear PRI 20-JUN-2021 DEFINITION Pan troglodytes homeobox D4 (HOXD4), mRNA. ACCESSION NM_001081569 XM_001153123 VERSION NM_001081569.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXD4" /note="propagated from UniProtKB/Swiss-Prot (A2T6X6.1); Region: Antp-type hexapeptide" misc_feature 469..633 /gene="HOXD4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 634..765 /gene="HOXD4" /note="propagated from UniProtKB/Swiss-Prot...
NM_001081569.1 - Pan troglodytes (chimpanzee) - NCBI
Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA. (742 bp)
gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(374..376,383..385,503..505,512..517,524..526) /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 742) AUTHORS Newman CS and Krieg PA. TITLE The Xenopus bagpipe-related homeobox gene zampogna is expressed in the pharyngeal endoderm and the visceral musculature of the midgut...
Synonym: bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A
NM_001085685.1 - Xenopus laevis (African clawed frog) - NCBI
Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA. (1111 bp)
uct="homeobox protein Nkx-2.6" /protein_id="NP_990468.1" /db_xref="CGNC:49622" /db_xref="GeneID:396037" /translation="MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP" misc_feature order(224..238,242..244,293..295,311..313,350..352, 356..361,368..373,377..385,389..394) /gene="NKX2-6" /gene_synonym="NKX2.8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 230..391 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="Homeobox...
Synonym: NKX2.8
NM_205137.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1474 bp)
codon_start=1 /product="homeobox 7" /protein_id="NP_182191.1" /db_xref="Araport:AT2G46680" /db_xref="GeneID:819280" /db_xref="TAIR:AT2G46680" /translation="MTEGGEYSPAMMSAEPFLTMKKMKKSNHNKNNQRRFSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQLETEYNILRQNYDNLASQFESLKKEKQALVSELQRLKEATQKKTQEEERQCSGDQAVVALSSTHHESENEENRRRKPEEVRPEMEMKDDKGHHGVMCDHHDYEDDDNGYSNNIKREYFGGFEEEPDHLMNIVEPADSCLTSSDDWRGFKSDTTTLLDQSSNNYPWRDFWS" misc_feature 297..449 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6
NM_130233.5 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Glycine max homeodomain/HOMEOBOX transcription factor (LOC100797862), mRNA. (1005 bp)
stop codon" CDS 168..884 /gene="LOC100797862" /note="homeobox-leucine zipper protein ATHB-12-like" /codon_start=1 /product="homeodomain/HOMEOBOX transcription factor" /protein_id="NP_001341790.1" /db_xref="GeneID:100797862" /translation="MEYTYSAGVEAETHTSSSTTPSRSKKRNNNTRRFSDEQIKSLETMFESESRLEPRKKLQLARELGLQPRQVAIWFQNKRARWKSKQLERDYGILQSNYNSLASRFEALKKENQTLLIQLQKLNHLMQKPMEPGQRCTQVEAANSMDSESENGGTMKCEAEGKPSPSMEISEHLLGVLSDDDTSIKVEDFGLEDEHGLLNFAKHVDGSLTSPEDWNAFESNDLLGQSTTDDYQWWDFWS" misc_feature 264..416 /gene="LOC100797862" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" misc...
NM_001354861.1 - Glycine max (soybean) - NCBI
Gallus gallus sensory organ homeobox (SOHO1), mRNA. (1820 bp)
gene="SOHO1" /gene_synonym="SOHO-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(423..425,432..434,552..554,561..566,573..575) /gene="SOHO1" /gene_synonym="SOHO-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 250..1805 /gene="SOHO1" /gene_synonym="SOHO-1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1820) AUTHORS Deitcher DL, Fekete DM and Cepko CL. TITLE Asymmetric expression of a novel homeobox gene in vertebrate sensory organs JOURNAL J. Neurosci...
Synonym: SOHO-1
NM_205386.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. (2200 bp)
LOCUS NM_001079361 2200 bp mRNA linear VRT 19-JUN-2021 DEFINITION Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. ACCESSION NM_001079361 VERSION NM_001079361.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 763..927 /gene="hmx3" /gene_synonym="nkx-5.1; nkx5-1; nkx5.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(763..765,772..774,892..894,901..906,913..915) /gene="hmx3" /gene_...
Synonym: nkx-5.1; nkx5-1; nkx5.1
NM_001079361.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Haplochromis burtoni distal-less homeobox 5a (dlx5a), mRNA. (1269 bp)
synonym="dlx5" /note="distal-less homeobox protein 5a; distal-less homeobox 5" /codon_start=1 /product="homeobox protein Dlx5a" /protein_id="NP_001273250.1" /db_xref="GeneID:102296998" /translation="MTGVFDRRIPSVKSADFESSFQLSSMHHPSQESPTLPESSATDSGYYSPAGGVAHGYCSPSSTSYGKPLNAYQYQYPGVNGSAGNYSTKSYTDYSSYTTPSYHQYAGTYSRVQAQPSPQEKEISEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQTQVKIWFQNRRSKMKKIMKNGELPPEHSPSSSDPMACNSPQSPAVWDTQGPSRPHSLQPQSINTTASNFLENTGSWYTSAGSSMTSHLQTPNSIQHSLALGAGTLY" misc_feature 264..530 /gene="dlx5a" /gene_synonym="dlx5" /note="Homeobox protein distal-less-like N terminal;...
Synonym: dlx5
NM_001286321.1 - Haplochromis burtoni (Burton's mouthbrooder) - NCBI
Xenopus laevis homeobox D8 L homeolog (hoxd8.L), mRNA. (1930 bp)
hoxd8.L" /gene_synonym="hox5.4; hoxd-8; hoxd8" /codon_start=1 /product="homeobox D8 L homeolog" /protein_id="NP_001083341.1" /db_xref="GeneID:398875" /db_xref="Xenbase:XB-GENE-920126" /translation="MSSYFVSPMYPKYKDAINPAFYECPYGQEVGSSSSRAPLVYAPQDYYHHHPGTLPSPGYQPAPCGITCHGDPSKLYGYDHFQRQHIFTTHQESEPVQYPDCKSPCASVGADPEHLHQNSPASHMFPWMRAQVAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENSKDKFPVSSQEGKEEADKKEGIHLEQQGREGTN" misc_feature 476..646 /gene="hoxd8.L" /gene_synonym="hox5.4; hoxd-8; hoxd8" /note="Homeobox; Region: Homeobox domain" misc_feature order...
Synonym: hox5.4; hoxd-8; hoxd8
NM_001089872.1 - Xenopus laevis (African clawed frog) - NCBI
Canis lupus familiaris cone-rod homeobox (CRX), mRNA. (3299 bp)
LOCUS NM_001003049 3299 bp mRNA linear MAM 18-JUN-2021 DEFINITION Canis lupus familiaris cone-rod homeobox (CRX), mRNA. ACCESSION NM_001003049 VERSION NM_001003049.1 KEYWORDS RefSeq. SOURCE Canis lupus familiaris (dog) ORGANISM Canis lupus familiaris Eukaryota; Metazoa; Chordata; Craniata;...gene="CRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 229..387 /gene="CRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 376..564 /gene="CRX" /note="propagated from UniProtKB/Swiss-Prot (Q8SQ03.1);...
NM_001003049.1 - Canis lupus familiaris (dog) - NCBI
Arabidopsis thaliana homeobox 12 (HB-12), mRNA. (1054 bp)
." /codon_start=1 /product="homeobox 12" /protein_id="NP_191748.1" /db_xref="GeneID:825362" /db_xref="TAIR:AT3G61890" /db_xref="Araport:AT3G61890" /translation="MEEGDFFNCCFSEISSGMTMNKKKMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEPEGRLDQGSVLCNDGDYNNNIKTEYFGFEEETDHELMNIVEKADDSCLTSSENWGGFNSDSLLDQSSSNYPNWWEFWS" misc_feature 251..403 /gene="HB-12" /locus_tag="AT3G61890" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12
NM_116054.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/en/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.200 | 0.200 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.352 | 0.152 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.358 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]