GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2019-10-20 09:47:23, GGRNA : RefSeq release 96 (Sep, 2019)



Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 04-AUG-2019 DEFINITION Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript...
Synonym: GRMZM2G136369; homeobox1; hox1a; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
sequence (NC_003071). FEATURES Location/Qualifiers source 1..1963 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1963 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Encodes a protein with similarity to WUS type homeodomain protein. Required for meristem growth and development and acts through positive regulation of WUS. Loss of function phenotypes include embryo lethality, hyponastic cotyledons, reduced...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AABR07030395.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (636 bp)
organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="Rhox homeobox family member 5" /db_xref="GeneID:24631" /db_xref="RGD:3295" CDS 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.1" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. (1394 bp)
gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 702..854 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 858..989 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8
NM_130055.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (1018 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /inference="Similar to RNA sequence, EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1, INSD:DR751539.1" /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1" /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS IN: sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_126204.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 07-JUN-2019 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox D12 (HOXD12), mRNA. (1419 bp)
LOCUS NM_205249 1419 bp mRNA linear VRT 03-AUG-2019 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 676..837 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(676..678,685..687,805..807,814..819,826..828) /gene="HOXD12" /note="specific DNA base...
NM_205249.1 - Gallus gallus (chicken) - NCBI - UCSC
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. (1058 bp)
INSD:DR750746.1,INSD:DR750857.1,INSD:DR750745.1" /inference="similar to RNA sequence, mRNA:INSD:BT031362.1,INSD:BT031368.1" /note="homeobox protein 21 (HB21); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Helix-turn-helix motif, lambda...
Synonym: ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2
NM_127411.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (2359 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..2359 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..2359 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" CDS 1..642 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_001335062.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1308 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(270..272,279..281,399..401,408..413,420..422) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 279..431 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
NM_001036473.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus Rhox homeobox family member 7 (Rhox7), mRNA. (900 bp)
Rhox homeobox family member 7" /protein_id="NP_001020825.1" /db_xref="GeneID:298353" /db_xref="RGD:1563189" /translation="MWFSNRRAKERACEKKAMPRSIPGAKAQMILPAGEGRNGEESERSSPGQEASATKWGEVEELGERDRTGSDGENLSAVGTSGIRNDWDKEGASSSRQKNESRPQKPVPECRWGMEDVQPVPVLIPRVQRIQLVQSRVQSVPLKVPTPRIRPVAVSATTVQPEPVLVPRRHLHDRFTDPELQELERERVFQRNHYLSAEERKELARVMGVSEAKVQRWFKKRREHFRREQSQSGGAPPGNTPPLSEDGAGALVYHP" misc_feature order(520..522,646..648,655..660,667..669) /gene="Rhox7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..666 /gene="Rhox7" /note="Homeobox domain;...
NM_001025654.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus msh homeobox 2 (Msx2), mRNA. (2162 bp)
LOCUS NM_013601 2162 bp mRNA linear ROD 13-AUG-2019 DEFINITION Mus musculus msh homeobox 2 (Msx2), mRNA. ACCESSION NM_013601 VERSION NM_013601.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 503..664 /gene="Msx2" /gene_synonym="BB122635; Hox-8; Hox8; Hox8.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(503..505,512..514,632..634,641..646,653..655) /gene="Msx2" /gene_...
Synonym: BB122635; Hox-8; Hox8; Hox8.1
NM_013601.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana WUSCHEL related homeobox 10 (WOX10), partial mRNA. (594 bp)
db_xref="TAIR:AT1G20710" CDS 1..594 /gene="WOX10" /locus_tag="AT1G20710" /gene_synonym="F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B" /note="WUSCHEL related homeobox 10 (WOX10); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is:...
Synonym: F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B
NM_101923.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 5 (WOX5), mRNA. (1052 bp)
WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /note="Arabidopsis thaliana WOX5 protein mRNA" /db_xref="Araport:AT3G11260" /db_xref="GeneID:820297" /db_xref="TAIR:AT3G11260" CDS 327..875 /gene="WOX5" /locus_tag="AT3G11260" /gene_synonym="WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /inference="Similar to RNA sequence, EST:INSD:DR750862.1,INSD:DR751206.1,INSD:DR750861.1, INSD:EH977836.1" /inference="Similar to RNA sequence, mRNA:INSD:AY150812.1,INSD:AY251398.1" /note="WUSCHEL related homeobox 5 (WOX5); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),...
Synonym: WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B
NM_111961.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 3 (HAT3), mRNA. (1447 bp)
locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 784..936 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3
NM_115903.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 7 (WOX7), partial mRNA. (429 bp)
TAIR:AT5G05770" CDS 61..429 /gene="WOX7" /locus_tag="AT5G05770" /gene_synonym="MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7" /inference="Similar to RNA sequence, EST:INSD:DR750916.1,INSD:DR751352.1,INSD:DR750917.1" /note="WUSCHEL related homeobox 7 (WOX7); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: WUSCHEL related...
Synonym: MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7
NM_120659.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1474 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(288..290,297..299,417..419,426..431,438..440) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 297..449 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
NM_130233.5 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (826 bp)
xref="GeneID:838660" /db_xref="TAIR:AT1G20700" CDS 1..636 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /inference="Similar to RNA sequence, EST:INSD:DR751559.1,INSD:AA585837.1,INSD:T22843.1, INSD:DR751560.1" /inference="similar to RNA sequence, mRNA:INSD:AJ441297.1" /note="WUSCHEL related homeobox 14 (WOX14); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: WUSCHEL...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_101922.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. (1144 bp)
LOCUS NM_010420 1144 bp mRNA linear ROD 28-MAY-2019 DEFINITION Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. ACCESSION NM_010420 VERSION NM_010420.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Rpx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 689..850 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(689..691,698..700,818..820,827..832,839..841) /gene="Hesx1" /gene_...
Synonym: HES-1; Rpx
NM_010420.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Homo sapiens double homeobox 5 (DUX5), mRNA. (594 bp)
DUX5" /gene_synonym="DUX1" /note="double homeobox protein; alternative translation start site; double homeobox protein 1" /codon_start=1 /product="double homeobox protein 5" /protein_id="NP_036281.2" /db_xref="GeneID:26581" /db_xref="HGNC:HGNC:3083" /db_xref="MIM:611444" /translation="MPAEVHGSPPASLCPCQSVKFRPGLPEMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQASIRCNAAPIG" misc_feature 160..297 /gene="DUX5" /gene_synonym="DUX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: DUX1
NM_012149.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Arabidopsis thaliana homeobox 12 (HB-12), mRNA. (1054 bp)
." /codon_start=1 /product="homeobox 12" /protein_id="NP_191748.1" /db_xref="GeneID:825362" /db_xref="TAIR:AT3G61890" /db_xref="Araport:AT3G61890" /translation="MEEGDFFNCCFSEISSGMTMNKKKMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEPEGRLDQGSVLCNDGDYNNNIKTEYFGFEEETDHELMNIVEKADDSCLTSSENWGGFNSDSLLDQSSSNYPNWWEFWS" misc_feature 251..403 /gene="HB-12" /locus_tag="AT3G61890" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
NM_116054.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 8 (WOX8), mRNA. (1151 bp)
db_xref="TAIR:AT5G45980" CDS 36..1013 /gene="WOX8" /locus_tag="AT5G45980" /gene_synonym="MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B" /inference="Similar to RNA sequence, EST:INSD:DR750890.1,INSD:AV557790.1,INSD:DR750889.1, INSD:AV556647.1" /inference="similar to RNA sequence, mRNA:INSD:AY251400.1" /note="WUSCHEL related homeobox 8 (WOX8); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: homeobox-3 (TAIR:AT2G33880.1); Has 568 Blast hits to 538...
Synonym: MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B
NM_123966.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Glycine max homeobox protein SBH1 (H1), mRNA. (1515 bp)
xref="CDD:335474" misc_feature 1056..1175 /gene="H1" /gene_synonym="Sbh1" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:310480" exon 594..849 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" exon 850..1091 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" exon 1092..1515 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1515) AUTHORS Ma H, McMullen MD and Finer JJ. TITLE Identification of a homeobox-containing gene with enhanced expression during soybean (Glycine max L.) somatic...
Synonym: Sbh1
NM_001251129.1 - Glycine max (soybean) - NCBI
Mus musculus NK2 homeobox 5 (Nkx2-5), mRNA. (1524 bp)
Synonym: Csx; Nkx-2.5; Nkx2.5; tinman
NM_008700.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus msh homeobox 1 (Msx1), mRNA. (1931 bp)
LOCUS NM_010835 1931 bp mRNA linear ROD 21-AUG-2019 DEFINITION Mus musculus msh homeobox 1 (Msx1), mRNA. ACCESSION NM_010835 VERSION NM_010835.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;..." /db_xref="CDD:238039" misc_feature 775..936 /gene="Msx1" /gene_synonym="AA675338; AI324650; Hox-7; Hox7; Hox7.1; msh" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="Msx1" /gene_synonym="...
Synonym: AA675338; AI324650; Hox-7; Hox7; Hox7.1; msh
NM_010835.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus BARX homeobox 1 (BARX1), mRNA. (1170 bp)
LOCUS NM_204193 1170 bp mRNA linear VRT 04-AUG-2019 DEFINITION Gallus gallus BARX homeobox 1 (BARX1), mRNA. ACCESSION NM_204193 VERSION NM_204193.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...BARX1B" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 465..626 /gene="BARX1" /gene_synonym="BARX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(465..467,474..476,594..596,603..608,615..617) /gene="BARX1" /gene_...
Synonym: BARX1B
NM_204193.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), mRNA. (1365 bp)
. FEATURES Location/Qualifiers source 1..1365 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene 1..1365 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Encodes WOX14, a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332460.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Mus musculus homeobox A6 (Hoxa6), mRNA. (2254 bp)
LOCUS NM_010454 2254 bp mRNA linear ROD 21-JUL-2019 DEFINITION Mus musculus homeobox A6 (Hoxa6), mRNA. ACCESSION NM_010454 VERSION NM_010454.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..678 /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 488..2254 /gene="Hoxa6" /gene_synonym="Hox-1.2" /inference="alignment:Splign:2.1.0"...
Synonym: Hox-1.2
NM_010454.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Zea mays knotted related homeobox 8 (LOC606458), transcript variant 2, mRNA. (1400 bp)
LOCUS NM_001319770 1400 bp mRNA linear PLN 11-AUG-2019 DEFINITION Zea mays knotted related homeobox 8 (LOC606458), transcript variant 2, mRNA. ACCESSION NM_001319770 XM_008667276 VERSION NM_001319770.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta;...Region: ELK; pfam03789" /db_xref="CDD:281743" misc_feature 1017..1136 /gene="LOC606458" /gene_synonym="GRMZM2G135447; knox8; knox8a" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" exon 561..698 /gene="LOC606458" /gene_synonym="GRMZM2G135447; knox8; knox8a" /...
Synonym: GRMZM2G135447; knox8; knox8a
NM_001319770.1 - Zea mays - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (866 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..866 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene <1..866 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Encodes WOX14, a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332461.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Mus caroli distal-less homeobox 3 (Dlx3), mRNA. (2578 bp)
XM_021178287.1 - Mus caroli (Ryukyu mouse) - NCBI
Gallus gallus homeobox B4 (HOXB4), mRNA. (1176 bp)
LOCUS NM_205293 1176 bp mRNA linear VRT 04-AUG-2019 DEFINITION Gallus gallus homeobox B4 (HOXB4), mRNA. ACCESSION NM_205293 XM_001235893 VERSION NM_205293.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Chox-Z" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 741..902 /gene="HOXB4" /gene_synonym="Chox-Z" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(741..743,750..752,870..872,879..884,891..893) /gene="HOXB4" /gene_...
Synonym: Chox-Z
NM_205293.1 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar homeobox protein HoxC5ba (hoxc5ba), mRNA. (806 bp)
LOCUS NM_001141621 806 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC5ba (hoxc5ba), mRNA. ACCESSION NM_001141621 VERSION NM_001141621.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxc5ba" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 553..714 /gene="hoxc5ba" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(553..555,562..564,682..684,691..696,703..705) /gene="hoxc5ba" /note="specific DNA...
NM_001141621.1 - Salmo salar (Atlantic salmon) - NCBI
Mus musculus homeobox A5 (Hoxa5), mRNA. (1877 bp)
e0203391 (2018) PUBMED 30169530 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1877) AUTHORS Cao W, Huang H, Xia T, Liu C, Muhammad S and Sun C. TITLE Homeobox a5 Promotes White Adipose Tissue Browning Through Inhibition of the Tenascin C/Toll-Like Receptor 4/Nuclear Factor Kappa B Inflammatory Signaling in Mice JOURNAL Front Immunol 9, 647 (2018) PUBMED 29651293 REMARK GeneRIF: this study shows that homeobox a5 promotes white adipose tissue browning through inhibition of the tenascin C/Toll-Like Receptor 4/Nuclear Factor Kappa B inflammatory signaling in mice Publication...
Synonym: Hox-1.3
NM_010453.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ventral anterior homeobox 2 (Vax2), mRNA. (879 bp)
misc_feature 220..303 /gene="Vax2" /note="Region: vax upstream domain" misc_feature 304..483 /gene="Vax2" /note="Region: homeobox" misc_feature order(307..321,325..327,376..378,394..396,433..435, 439..444,451..456,460..468,472..477) /gene="Vax2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 313..474 /gene="Vax2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(313..315,322..324,442..444,451..456,463..465) /gene="Vax2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_...
NM_022637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus pahari distal-less homeobox 3 (Dlx3), mRNA. (2596 bp)
XM_021213200.1 - Mus pahari (shrew mouse) - NCBI
Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. (1216 bp)
LOCUS NM_001141626 1216 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. ACCESSION NM_001141626 VERSION NM_001141626.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxb9ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 651..812 /gene="hoxb9ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(651..653,660..662,780..782,789..794,801..803) /gene="hoxb9ab" /note="specific DNA...
NM_001141626.1 - Salmo salar (Atlantic salmon) - NCBI
Rattus norvegicus ventral anterior homeobox 1 (Vax1), mRNA. (1011 bp)
misc_feature 214..297 /gene="Vax1" /note="Region: vax upstream domain" misc_feature 298..477 /gene="Vax1" /note="Region: homeobox" misc_feature order(301..315,319..321,370..372,388..390,427..429, 433..438,445..450,454..462,466..471) /gene="Vax1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 307..468 /gene="Vax1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(307..309,316..318,436..438,445..450,457..459) /gene="Vax1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_...
NM_022636.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. (1046 bp)
LOCUS NM_001141665 1046 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. ACCESSION NM_001141665 VERSION NM_001141665.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxc11ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 809..970 /gene="hoxc11ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(809..811,818..820,938..940,947..952,959..961) /gene="hoxc11ab" /note="specific DNA...
NM_001141665.1 - Salmo salar (Atlantic salmon) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.191 | 0.191 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.340 | 0.149 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.347 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]