GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2024-06-18 00:50:50, GGRNA : RefSeq release 224 (May, 2024)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Telopea speciosissima uncharacterized LOC122670138 (LOC122670138), ncRNA. (148 bp)
alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:122670138" ncRNA 1..148 /ncRNA_class="lncRNA" /gene="LOC122670138" /product="uncharacterized LOC122670138" /db_xref="GeneID:122670138" ORIGIN // tttctacaagagatggtgtgcgaaacagtttttaatggaaaggaagaacttagtcaatctcttcttgaaagcaagcgaggaagacaagctgaaggtattggaattgtatatgccagatactgaggacatcaatgaagactgatgaatg
position 55
XR_006334132.1 - Telopea speciosissima - NCBI
PREDICTED: Citrus clementina protein STRICTOSIDINE SYNTHASE-LIKE 4 (LOC18050416), mRNA. (1112 bp)
agtgatttcaagctcatggctccgaagagtttcctgctagcttgtttacttgcttttactctacaattcttcttctcgcctccagtatcatcttcagcttctcttctttccacctccaaggaaagctcctctatgaaggatttgattaaacttggagaaggatgtgtgagccacccagaggatgtttctgttgtggttagaaagggtgcgctgtatacagctactaatgatggttgggtcaagtatttcatcctccataatgaaaccttggttaattggaagcacatagacagtcaatctcttcttggactcacagcaacaaaggaaggtgacgtcattatatgcgacagtaaaaaaggtttgtttaaggttaccgaagaaggcgtaaaggttcttgatccagatgtaagatttgcaaatgatgtgatcgatgcatcagatggcacgttgtattttactgtctcaagcaccaaatatacccccgcagatttctacaaagacatggctgagggaaatccttacggccagttgctcaaatatgatcctaaatcgaaccaaacaacagttttgcaagagggattttactttgctaatggcatt...
position 298
XM_006445687.2 - Citrus x clementina - NCBI
PREDICTED: Citrus sinensis protein STRICTOSIDINE SYNTHASE-LIKE 4-like (LOC102608831), mRNA. (1352 bp)
agtgatttcaagctcatggctccgaagagtttcctgctagcttgtttacttgcttttactctacaattcttcttctcgcctccagtatcatcttcagcttctcttctttccacctccaaggaaagctcctctatgaaggatttgattaaacttggagaaggatgtgtgagccacccagaggatgtttctgttgtggttagaaagggtgcgctgtatacagctactaatgatggttgggtcaagtatttcatcctccataatgaaaccttggttaattggaagcacatagacagtcaatctcttcttggactcacagcaacaaaggaaggtgacgtcattatatgcgacagtaaaaaaggtttgtttaaggttaccgaagaaggcgtaaaggttcttgatccagatgtaagatttgcaaatgatgtgatcgatgcatcagatggcacgttgtattttactgtctcaagcaccaaatatacccccgcagatttctacaaagacatggctgagggaaatccttacggccagttgctcaaatatgatcctaaatcgaaccaaacaacagttttgcaagagggattttactttgctaatggcatt...
position 323
XM_006485118.4 - Citrus sinensis (sweet orange) - NCBI
PREDICTED: Telopea speciosissima uncharacterized LOC122662367 (LOC122662367), ncRNA. (304 bp)
product="uncharacterized LOC122662367" /db_xref="GeneID:122662367" ORIGIN // acagaacaaactcactcttactgaaaatcaagtttcgggggtgaatgtcttctcgcaaggtttctctggaaatcattttaaggggaaatcttctttccagaaacctgcttatagtttcctagagtccgtgctgccggggaaatcatcttcagcaaaaaccagttatttgcagggaagagagtggaaatgatatacgtggacatcttcaatctcttcttgtactaaatgtttctcaacaagagagacatgtgctgtaagcctgtaactgcgaagaattagatctcgaagggatctatttcgtttt
position 207
XR_006333008.1 - Telopea speciosissima - NCBI
PREDICTED: Camelus ferus uncharacterized LOC116657067 (LOC116657067), ncRNA. (330 bp)
gene="LOC116657067" /product="uncharacterized LOC116657067" /db_xref="GeneID:116657067" ORIGIN // accacatcacaaacaaaagtcctaataaaagtcgctgactaggactatcctcgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtacacatgaaagagatgtatttgctcagggtctatcaatcttgttctgcctgttttctcaagtcagcagccttatctttacatttactccactcaatctcttcttgtcattttccctttctgtctgaaaataactacccccaagtctgcaaagcatcatctttgtattccatttcttgttgtaaagagtttgtgacattctgcgagatggacatgctagatcggaagagca
position 193
XR_004311999.1 - Camelus ferus (Wild Bactrian camel) - NCBI
PREDICTED: Beta vulgaris subsp. vulgaris uncharacterized mitochondrial protein AtMg00310-like (LOC130591735), mRNA. (381 bp)
ORIGIN // atgaaagaagctgcaagggtggaaagagaaattgctatccaccccgggaaagaggtgcttattaaattagtggcgcaagctattcccacgtatatgatgagtgtattcagccttcctagcggattgattgatgagattcattcgttgctggctcgattttggtgggggtcctctgacactgataggaagatgcattggcatagttgggatacgttgtgctaccccaaatcgatgggcggtcttggctttagggacctacactgcttcaaccaatctcttcttgcaaagcaagcatggcggttatgtacgggggaccagactcttctttatcggctgctgcaagcacgatactttaagtcttcggaatttctggaggcgtga
position 271
XM_057395547.1 - Beta vulgaris subsp. vulgaris - NCBI
PREDICTED: Rousettus aegyptiacus uncharacterized LOC107512815 (LOC107512815), transcript variant X2, ncRNA. (319 bp)
GeneID:107512815" ncRNA 1..319 /ncRNA_class="lncRNA" /gene="LOC107512815" /product="uncharacterized LOC107512815, transcript variant X2" /db_xref="GeneID:107512815" ORIGIN // cgtcagccggcgctgaactgtgacggcagcgctcacggacccgcggctcgtgacggcattattgggggcgaccatcgacctggatattttttctgcatatgaaaccccgactgacaatctcttcttgcgacgctcgacggtgaagcgccctgttcttccagcagccacggcctctcatgagaagctgctgtcatttaagtgacaacctgcttacagcaaaacgacgccagacgccgttggtttgtgaacggccctcaccacgcggtggacgacgccccgcagaccggcgcccaaaccctgggagcctgcgaagacctcg
position 115
XR_001597394.2 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
Penicillium citrinum uncharacterized protein (N7469_005960), partial mRNA. (414 bp)
Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgccttatgtagctgctacaattaaagaggctatgggatggagggcagttgttccgttggcttttccgcatgctactactcaagcgtctgtgactgacgttaatctccgtgatcagtacggttatggacccggtcgtcggattcgtcctgggatgcatcttgctgaacgcaatctcttcttggctatcgcgaaaatgagttgggtatttgatgtcggtactggtaatggtgaaaagacaaggttgcctattgaaccggatgttgatcatcagacgggatattgggagggcttgatcttgggtgctcggccattcccttgtcagatgtctgtgaggtctgaggcgagaagagatgccattgtgcgggaatttcagaagatgaattctgatatgttttcgagattcgcattttga
position 171
XM_056644879.1 - Penicillium citrinum - NCBI
Penicillium angulare uncharacterized protein (N7478_008204), partial mRNA. (438 bp)
JOURNAL Submitted (13-DEC-2022) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgcgcgccgctttgacgtgcagttgttcccatggattctatatggagaggaaaattgtgtacagcgttggtttgggatttatgattttcagcaaagtcagtctcaaaaagactgataggctcgtccttgacacggagattatcaatctcttcttgatcaatctcatcaccactgccaccatcgaagctctcagggatatggtagacaacgtcctcagagaagttgtaactcgcagaagtgtcattctcgcacgcaaaatcgtcaatgttgccaaaaacaacatcctcgttctcataatcaatgtccgattcagagacccccggggcctgctcaagaacgaattctggatcctcggggacggctgccttcttttgctgtggatgggatttcggttgagcagcagcagcagcagcagcagaagatggagcagactgtaa
position 144
XM_056924418.1 - Penicillium angulare - NCBI
PREDICTED: Acropora digitifera uncharacterized LOC107337268 (LOC107337268), ncRNA. (444 bp)
including 41 samples with support for all annotated introns" /db_xref="GeneID:107337268" ncRNA 1..444 /ncRNA_class="lncRNA" /gene="LOC107337268" /product="uncharacterized LOC107337268" /db_xref="GeneID:107337268" ORIGIN // cagaatgggtgttcctcttgtggttttgcttgaattctgttctgagggtgataacgtcttgatgccgtcaatctcttcttgtctgctaatgagtggctcaaatttgttcccacgaaagaggtggaaaatccgttctttggacaaacaagtaattttgggattccagcatcttggtctttaatgtttggatcaccaatgcattggcatggaaacctattttagtgaggcagactcatgagttatgtacttaccataactttcacgtttgtttgatcactgttttgcgcttagtttagcaaggaacctctccatgttacgggtcattatttgtagtatttgctcaaaacgttaccatgaaacagctaccacgtgtcaaa...
position 69
XR_001562778.1 - Acropora digitifera - NCBI
PREDICTED: Cygnus olor uncharacterized LOC121066939 (LOC121066939), ncRNA. (369 bp)
LOC121066939" /db_xref="GeneID:121066939" ORIGIN // agacacacctgatgatttattattttcagtagcttatttgtgaatatgaaaaaatgtctttcttgatattcaccaaatgatataaatgcctttactctccagctcttcattttttctgctcactggtgctttgaatgcagtggaaaggcatttctggtctccatggcttctcttaaatgcacgcagagaagggaacataatagagatgatgagccctagcaaattagccaactgcaatctcttcttgttcagttaacgcgcctgtacagccagataccagccacgggagcaaagggctgtgagaggagatttggagcccaagtataggagtagagaagctctcagctgtttgtagcatgtctagaagca
position 235
XR_005818030.1 - Cygnus olor (mute swan) - NCBI
PREDICTED: Lontra canadensis late cornified envelope protein 1A-like (LOC116858788), mRNA. (414 bp)
ORIGIN // atggggcccaaggtccaaaacaggagctatgaggccttccaggtggcacttgccaaagagaatgaggcagaaaatcaaacttccgactccatcagcgagatgtcctaccagcagaatcagcagcagtgccagtcccctcccaagtgtcccaccccgaagtgccctccaaagtgtcccccaaagtgcccctcaatctcttcttgctgcagtgtcagctctgggggctgctgcagctccagctccgggggtagaagctgctgcagttttggaggtggcagctcctgcctgagccaccacagacgacacaggtcccactgtcacagatgccagagctctggctgctgcagccagccctcagggggctccagctgctgtggagggggcagcagtcagtcctctggaggctgttgctga
position 191
XM_032843692.1 - Lontra canadensis (Northern American river otter) - NCBI
PREDICTED: Manis pentadactyla uncharacterized LOC118908090 (LOC118908090), ncRNA. (484 bp)
ggcctcttatccacgtctgcagaaaaatcactcacgggatttgacatctgctgcacaccatggagaagacaccttattgatgaaaaagaacacagttcctgaggattgctctgggatggggaaaacttgatcatcttctgccccttgtgctcacagaaactgtttgaggtctgtctcctggggaccccaccctccatttttaggactgaatacctgaagtacagttgtcatcctgttgaatcttatgttacctgcattttatgtcttcaacttctctggttttgtttaagcaaacaatctcttcttgagaagggacagaagggaaataaaattctagatacccaatgtgtccaaaaa
position 422
XR_008998512.1 - Manis pentadactyla (Chinese pangolin) - NCBI
PREDICTED: Rousettus aegyptiacus uncharacterized LOC107512815 (LOC107512815), transcript variant X1, ncRNA. (409 bp)
GeneID:107512815" ncRNA 1..409 /ncRNA_class="lncRNA" /gene="LOC107512815" /product="uncharacterized LOC107512815, transcript variant X1" /db_xref="GeneID:107512815" ORIGIN // cgtcagccggcgctgaactgtgacggcagcgctcacggacccgcggctcgtgacggcattattgggggcgaccatcgacctggatattttttctgcatatgaaaccccgactgacaatctcttcttgcgacgctcgacggtgaagcgccctgttcttccagcagccacggcctctcatgagaagctgctgtcatttaagtgacaacctgcttacaggaaacctctccatgaaagaagaagaaaacaggtttttatcgaataagcagtaaaccagaacgtgacgtgcatccaggcaatccagtgggacatctcacctggacagagccagactggtgcgacctgtcacacacacgttctcgggatgagcaccagcttgtcttcaggtaagaggacttgacggcaccattta
position 115
XR_001597393.2 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Podarcis raffonei uncharacterized LOC128424167 (LOC128424167), ncRNA. (394 bp)
experiment="COORDINATES: polyA evidence [ECO:0006239]" /db_xref="GeneID:128424167" ORIGIN // ggtggggagagaaggagactctcctgagggcaacagtgagagaagggaacttgccagtggcccatctagtcctggatcctgttctcacagtggccaacaggcatcaatttacacttatttacattgtttatgttgaattgcacttgccattttattacccattcactcaggttggagagcttgttttcacaatctcttcttgtttgaatgaccctgaacaatttagcatcatcggcaaacttcactgctcacccctaattctcaattgtttttgaacaagttaaatagcagaggtctcagtgttgatctttttaaaataaaaaataaaataaggtgttgttaaagttttttcataatacaataagataaaagaaactaaataaaaacaaaaaca
position 190
XR_008332942.1 - Podarcis raffonei (Aeolian wall lizard) - NCBI
Penicillium crustosum uncharacterized protein (N7487_009046), partial mRNA. (531 bp)
JOURNAL Submitted (30-NOV-2022) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgcaggatatctacactaagatggatacaatggtagcggtgattctaacagacgtaaactttatgacaaacacaccgataattaccgatcaagcggacgagcaggaggtctatgagggatactcaaattttgtacaatctcttcttgagctcatggacgccgtatcgagcagcgcagcccagctgaaatcgatcaacgaaacaaccaagaataacgttccctttggaattcgcatcttgcaaactgccgttgacgtgagttccctaattaactcttcgctaccacctgaggagatgatcgatgagatgctgacaccttacaaggcctacttctacaacatcatcggtctcttcccagccaacagcgcatacaacgcccaggccaacaaccagaaggctcaggtggatacgcattgcttccaggccgtctgggcatttgatcgcaggtat...
position 136
XM_056876776.1 - Penicillium crustosum - NCBI
PREDICTED: Haliotis rubra biogenesis of lysosome-related organelles complex 1 subunit 3-like (LOC124274838), transcript variant X2, mRNA. (1880 bp)
aatcttcagttccacagtcacctggtgagtctggggagccacgcctacatgtctgctgccaagcacatcaacaacaccacacagcagctgctcaagtcacatgttgctatccaggacgtgtctcacaacatgaggctgatgaccaacgacctgttccgcctggaggacaagatcaacattatctcctcctgtagcctgttacctgacatcaacatagaactgtcgtcatagcaacaccatctcctcctatgacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacaccatctcttcttgtaacctgttgcttgacatcaacgcagaactgtcatcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaagaccatctcctcctgtta...
position 649
XM_046710202.1 - Haliotis rubra (blacklip abalone) - NCBI
Penicillium brevicompactum uncharacterized protein (N7506_009931), partial mRNA. (537 bp)
Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atggcagcctcgttgtcttcgtcggttacatcgctgcagtcatcgctgcagctgctggataattcaataaccaccctcgactcgggcgtgagcgactttcctcgcctttgtaaggtcctttctacaacgcgacattttgagctactaccagagccaacactgcgtgaggcacaacaatctcttcttgatgagatcacccccagcatcgcccatcttctcacactatcatcaaaccacgtcgaaaagctcgcacgccgtgaggaaagcttaaaagcaaaatgcgatcttcaagaaggaagactctcatctaatgcagagagccgcccatctgctcctcgcagtcaaccccagagcagcgcattgcggggtcgcatggcggggtctagcgctggctcatcgggcagcgcagcagccaaagccgcagaatacaagagactcgtacagaagaaagagcgactcaagtttgcggttgaccgattgga...
position 175
XM_056959224.1 - Penicillium brevicompactum - NCBI
Laccaria bicolor S238N-H82 uncharacterized protein (LACBIDRAFT_325715), partial mRNA. (411 bp)
Wuyts,J., Martin,F. and Grigoriev,I.V. CONSRTM US DOE Joint Genome Institute (JGI-PGF) TITLE Direct Submission JOURNAL Submitted (19-NOV-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA atgtactctcggtctccatggcctgttgcatctcctgctgcaccactctcaagtggtaatcaatctcttcttgtcattcacggcgaacttcctcttgcctctgttctcaagtatttggatgagaattgtgtcgatgagaccaacattgtcgatggtgacacagacgtcgtcaatggtgacgcagacgtcgtcaatggtgacgcagatgtcgtcaatggtgacacagacgtcgacggtgatgtagacgtcgtcggtgttgacacagatggtggcacagacgtcgtcgatgatgacacaaatggtggcacagacgttgttgatggtggcacagacactgttggaggtgacacagacgtcgaggttgagc...
position 61
XM_001879458.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Haliotis rubra biogenesis of lysosome-related organelles complex 1 subunit 3-like (LOC124274838), transcript variant X1, mRNA. (1893 bp)
aatcttcagttccacagtcacctggtgagtctggggagccacgcctacatgtctgctgccaagcacatcaacaacaccacacagcagctgctcaagtcacatgttgctatccaggacgtgtctcacaacatgaggctgatgaccaacgacctgttccgcctggaggacaagatcaacattatctcctcctgtagcctgttacctgacatcaacatagaactgtcgtcatagcaacaccatctcctcctatgacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacaccatctcttcttgtaacctgttgcttgacatcaacgcagaactgtcatcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaagaccatctcctcctgtta...
position 662
XM_046710201.1 - Haliotis rubra (blacklip abalone) - NCBI
Caenorhabditis elegans Protein suex-1 (suex-1), mRNA. (413 bp)
org REFERENCE 4 (bases 1 to 413) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA aaatgcaatctcttcttgtattctgtcttgccacaattattctatcaaacttcacagaggcttctgcagatttggagacagcttcacaaagtctgaagcatccgaggaatttgggatggaaggctcctgaaggacatcgcgaaaaacgatatggtggatggggaggtggatatccctacggcggctacggtggatatggtggaggttacggtggcggatatggaggcggatacggaggagggtatggcggacgatatggcggaaactatggaagcagctcatggggatcatattcgagttatagttctggtggatacag...
position 6
NM_062648.3 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Arabidopsis lyrata subsp. lyrata ubiquitin-conjugating enzyme E2 36-like (LOC110230388), mRNA. (391 bp)
gtgattttagacattgggaaatggtggaatcatatgagcagcatggtgatgaaaatgatgggcatgttccatatgtaccttctggtgacagaattatggaggatatgcgggattctatcactacagagatggctgaaggaacgagacttccatattaacagctcccggtatttcaatgttatgattcttggacctacacaatcaccttatgaaggagttgggtttgaatcgagaagcaaatacttgtttggtaaagtctctatctagattaagcaaatcgaggaacaaaaccaatctcttcttgctctgttttaagacactgctttgattattatgtccctaatcttacattatgaatgtatttcactaaagcagtgacattggttggttt
position 292
XM_021033133.1 - Arabidopsis lyrata subsp. lyrata - NCBI
PREDICTED: Prosopis cineraria uncharacterized LOC129311497 (LOC129311497), mRNA. (565 bp)
pfam09402" /db_xref="CDD:430586" ORIGIN // aacagcagcaaacaagggtgccgtaaaaggcggtctgagcatcccgctcggccggacacatcactctgatctcttccaaatgaagcgcgcaaaacccaagtcccattccaaaacttcaaatcattctcacaattcttctccttctttgaaatcgttcatagaaccccctcctgatttctttccctcgaagcacgagttcctcaggctcatcgtcgtccttgcattcgcatcagcagttgcttggacatgcaatctcttcttgacatcttttattaatccctccaccaagcccttttgcgatagcaacgtagactttccggattcattttccgatgattgtgaaccttgtccaagtaatggagcatgttacgatggcaaattggaatgtctccagggctaccgaaagcatgggaagttgtgtgtagaagatggagatattaataaatcagctaaaaaaatttcggacagagtaaaatgtagcctatgtgaagattatgctcagtatttgtgctatggagtcggatcagtttgggttcaagaggatgaaatatggaaaa...
position 250
XM_054953827.1 - Prosopis cineraria - NCBI
PREDICTED: Saccostrea cucullata uncharacterized LOC134258183 (LOC134258183), partial mRNA. (440 bp)
protein LOC134258183" /protein_id="XP_062596710.1" /db_xref="GeneID:134258183" /translation="MMQSLLVFVISVASIKTLHGSNGVMYPSSLSTLNEVPNCPRNQHDWEKAAARKDCNQISKSDNKPFVYHCLINEWANATVEVCAPTWFVSGFCAMYSSSDARVIDNFNYDCTHYTPPCPQRYISSEAYKYGVCYDI" ORIGIN // tccattaacacaaagtcttggtaaaaaagtaaatgatgcaatctcttcttgtatttgtcatatcagttgcatcaataaaaacactgcatggaagcaatggagttatgtatccatcgtcattgtcaacgcttaatgaagttcccaattgtcctagaaatcaacatgattgggaaaaagctgcagccagaaaggattgcaaccaaattagtaaaagtgacaacaagccctttgtttatcactgtttaataaatgaatgggcaaatgctacagttgaagtatgtgctccaacatggtttgtctcaggattctgtgcaatgtacagttcttccgatgcaagagttattgacaactttaactac...
position 39
XM_062740726.1 - Saccostrea cucullata (small rock oyster) - NCBI
PREDICTED: Ahaetulla prasina mucin-2-like (LOC131184643), transcript variant X4, mRNA. (456 bp)
gcggcggctgctgctgctgctgcttctcccaggggcgctgctgagcttcctcccgcaggcgaccccgcacccgagtgtgacacaccgttacgaaaatgttaaagcagtggagatatctgtgcagccaactgcagttgaagaggttatatcgggagggaaagatgctgttgaagtccagcatcaatctaaaaagaagaaaaatgacattatagagttgaaagagaccttggaggtcttctagtccaaatccctgctcaagcaggagatcctatccattctggacaaattactatccaatctcttcttgaaaagttccaa
position 433
XM_058156240.1 - Ahaetulla prasina - NCBI
PREDICTED: Herrania umbratica uncharacterized LOC110427542 (LOC110427542), mRNA. (417 bp)
misc_feature 144 /gene="LOC110427542" /note="gag-polypeptide of LTR copia-type; Region: Retrotran_gag_2; pfam14223" /db_xref="CDD:464108" ORIGIN // atggcagaatgcagttctattagaccccatgtgctgaagatgattgaactcatcgagagacttggacaattgggattagcaatggatcatgagcttagtatagacttagttctacaatctcttcttgacagctttagtcagttcatgttgaacttccatatgaatcgattggaagccacttttcttgaacttttgaatatgctaaacatggtagagtggtccatcaggaaagataaaggatcattgcttcttgtttcttcttttgaggctcatacgaaacaacagaagaagaaagcccaaaaagggaagaaggtaaaatctcaaaatgagaaggtgctgaagcctaagagaggtgtcaaaaaggacaaagagaaagatattttgccatcattgtggcaaacttgggcattggaatag
position 115
XM_021443097.1 - Herrania umbratica - NCBI
Trematosphaeria pertusa uncharacterized protein (BU26DRAFT_500137), partial mRNA. (528 bp)
CA 94598-1698, USA atgaccgacaccgcggactttgagcaattttgcttaactacactctacaatgctattccgatgctcgacaaccccagcgaccggtacgagtggaataatagggtgtgcgattttattgagatttcctctgtcgccgaagatggtgctcctccaccaaacaaagatcaggcaaaggaatggtatcgccgacagaaactctacacagccatgatcatgaagaagctgtcgcacaacgctgcgccgcgaattaaggccttagggatcagtgacgtgcaatctcttcttgaagctgtgcgagagcgcttcaactttagccgcctcaaggacgaggcaatcgaggaagagtaccgatccggccagcggggcaatgagccggcgaaggcgcagcgtgttagcaaccagattcaaactcttacccgccagatattgatatcaccggacgaaaccagatgccagattcacatagacaaggttccgttttgctcattttgtcccaccaaactcgcacagcaacccagaaacatttag
position 274
XM_033826478.1 - Trematosphaeria pertusa - NCBI
Brettanomyces bruxellensis uncharacterized protein (BRETT_000934), partial mRNA. (543 bp)
Research, Australian Wine Research Institute, Corner of Hartley Grove and Paratoo Road, Urrbrae, SA 5064, Australia atggttgcataccaatttagttccgtttgtgagaattgtgaactaaatgtgaacatgagtgactcagataaaacagacaagaaatttccacgctcttctctttccagaacaactacaacgactagcataactacccctgttcacccaatggaattggttgtacaatctcttcttgaatcacctcttgagcttctaaatttgagtattcattcattgtatgaatcgcaaatgattctcacaacaatattagatcgaatgcagcggaaacttgacaaatgtcttaggggcattggtaaaagtaggcaagaaccaattactactgacacagatacgcaaaatttacaatatccaaacgagcatcgaaatagggcaaactcagatgatgatctgacaacacagccaggaccagacaaaagcttgacaattgaagaatatgctgccagaattcatacgatcaagctccgcattgtaaaa...
position 163
XM_041279492.1 - Brettanomyces bruxellensis - NCBI
PREDICTED: Drosophila subpulchrella uncharacterized LOC119551309 (LOC119551309), mRNA. (513 bp)
tgcatagagctgaagtgcttctgcatcctgatagccatcgtggaggtgctcatccgcgggttggatcgtttttttgtggatcgcgacagcatcctgggatttttgtccctcgtggtgagcggtatctacgtaatctgctgcatattccttcttcttggagccgtgctgggggtaaggtactttctgttgccctacctctcggtttcctgcctccgcttccttattttggttgccgagggcgtgtttgtggccacggaaggcttcgtcaatgaatatcttgtcttcgatgttctccaatctcttcttggtctatacttttggctggtggtcttctcctactacgatctgttgaaggacacctgagtttatatatttgtgcttacttttatattgtaaaaaatacttgtttagatctgagt
position 389
XM_037860603.1 - Drosophila subpulchrella - NCBI
Penicillium waksmanii uncharacterized protein (N7481_010380), partial mRNA. (621 bp)
attggcgttgaggaaatggagtccgccctccttacttctaaacaagagataaagcaagatgacacagtattactgtatatggcatacaacgaaagggtctccccggaggacccccgatggcagcatgatttccccggcctagcgccagaatcagtgcattggcttgctgacagaggttgcaaaatctttggcgttgaggctgtttcgcctgcacctgaaggtgaattgaacttcatcgcgcacaatatctgtggggagagaggcattacccatattgagggactcgacaatctacaatctcttcttgggcgtggaagatttcgatttattggtttcccgttaaagctcatgggcgctagtggaagtcctattagggccgtggctgtatttgaaaagtga
position 517
XM_057269599.1 - Penicillium waksmanii - NCBI
Rhizoctonia solani Lytic polysaccharide mono-oxygenase, cellulose-degrading (RhiXN_09028), partial mRNA. (567 bp)
China Agricultural University, Yuanmingyuan Xilu 2, Beijing 100193, China atgcgcttcctggctggtttattgactttggcgactttggcgtcgtccgttgtcgctcatggcattgtaactcaacctccaactcgcacactcgggagtgccatgattgcagcttgcggtgaaggtgctgtctcggctcaaaaatccaatgtcaagggaccgattgaaagccagattgccaagattgattccaactacaagcccgcgcaatgcaatctcttcttgtgccgtggccaacagtttgctgacaacaaggacaaagtccaaacctacaagactggtcaagtcgtgaacattgtactagacattgagaaccaccatcctgttggctatgcaaacgtatctgttatcgatactgccacaaacaagatggttggcaagcctctgattgcatgggatccttactttactggttatccgtaccctaaggatcaagagaacttcaacgtcactattccagagctcagcggcaaatgcaagactgccggagaatgtgttctacaataccactggtactcccgaacgg...
position 213
XM_043328844.1 - Rhizoctonia solani - NCBI
Aspergillus piperis CBS 112811 hypothetical protein (BO85DRAFT_383017), partial mRNA. (453 bp)
gtcttaaagctcatcgaatccaccaccatggatttccgcaacctatcattcactctcctcctgctatccactacagtcatgttatatttcagggctctattagcgcatcccatccacattattagcacccctgaatcagtgcagactgcagaaccagcgccaaccgacgccctcgccttcctcgacgagcccgtcttcaaaccactggcatctcacatagcagaccacccatatccatggcgtgataaacgtccattccaggagaccaattatgcgttactcatgggtgcagttcaatctcttcttgaggctgaggttgacgaggaagagggtggtgtgggtttgaacgagggtcatgggcaacaggacgtcgttgagattaactcgtctgagacatacattctctgggttggggataaggatgatgagaagtgttcttgcgcttag
position 301
XM_025656494.1 - Aspergillus piperis CBS 112811 - NCBI
PREDICTED: Theobroma cacao uncharacterized LOC108661919 (LOC108661919), mRNA. (507 bp)
cgtcataaggatgacgatgatcaggcagcatgcgtgatgctaaccagtatgactcctgagctccaaaagcagtatgagcacatggatgtccaatccataattcttcatcttagaaaattgttcgataaggaatggcgcattgagagatatgagatctctaaagaactattccgatgcaagatggtagaaatgagttttcttagaccccatgtgccgaagatgattggactcatcgagagacttagacaattgggattagcaatggatcatgggctaagtatagacttaattctacaatctcttcttgacagcttcagttag
position 481
XM_018120908.1 - Theobroma cacao (cacao) - NCBI
PREDICTED: Raphanus sativus precursor of CEP15-like (LOC108835208), mRNA. (657 bp)
polyA_site 657 /gene="LOC108835208" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN // tcaacaaagttggccctccaaaattttttataattcaatgtttctttcttatatagttatttaaatatgctcattatattgtaaacaacaccacacaatctcttcttggaccctaaagacatcaagaagaaagaagatccgtatatacaaattctcttatttttaccatttgattgtgttcttaaaaggtttcttcgcgatatggatgaaatgaagattaagcttcacgttttgttactctatttcttactcatctccgcagttccttcggttctcgggttcaaaatgagaggcactactactagatctgagccgggagcatttctcggcggagaatacttaccggcgatgaagagcaggaagttgatggtcacaaacatggaagttgattattcaggtgactattatgatggagcctcttcagcatcaccgtcaccacctttgcctgattatgatgatgatatctataaaaggcaaggtgatgtcccaagccccggt...
position 96
XM_018608490.2 - Raphanus sativus (radish) - NCBI
PREDICTED: Fukomys damarensis uncharacterized LOC104847975 (LOC104847975), ncRNA. (576 bp)
RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:104847975" ncRNA 1..576 /ncRNA_class="lncRNA" /gene="LOC104847975" /product="uncharacterized LOC104847975" /db_xref="GeneID:104847975" ORIGIN // ctggtgaatggaggctgacttcttgctctccaagaactgcaagtagctacccaatctcttcttgaaatcagcagtctgtgagctcactgtagtggggcagccagaaccttaaagcctaacaatgggacagtgacaagaagagaggtggagagaaactttcacagtccccctcttccactccaagagaagaaacacacggctttattatggtaccaagtccacctccagatagaagcaatacatctcctcttgaacaagactgtttctccagtttaagcaaatctatccaaactacctccaagctgcagtgaatcatacggtggctgaaggaactacactaagaaggacttgaaagactt...
position 52
XR_776269.2 - Fukomys damarensis (Damara mole-rat) - NCBI
PREDICTED: Lingula anatina protein FAM84B-like (LOC106176727), mRNA. (474 bp)
ggcagtgttagattcccttgtgccgggagacctggtggagttccaaaggtcgtggctcttctcccactgggccgtttatattggtaatgaagaagtggtccattttattgaacgcaattcaggaggtgtcttcagttcctctagtgagcgttctatgacgggggtagttcgaagggattccttttggacagtggcagggaggagtaaggcgttcaaaaacaacagaagggacgccaaatacagctgtgatgtgatagtgacgagggctctgtcaaagctgggagtgagcgagttcaatctcttcttgagaaatagtgaacattttgtagcctggtgtagatatggtgaagagtgcagtgaacaggcacaaaccatctggacaatgtttttggggtctatggctgtaattgtggggggcattgccgcactcactggccttaggcgatag
position 321
XM_013559232.1 - Lingula anatina - NCBI
Penicillium waksmanii uncharacterized protein (N7481_007601), partial mRNA. (669 bp)
ctgctctctttggaccagactttccaccctccattcttcgcgacatgcgagtatcaccgactactgcgccgaagctcgggatattgaaatgcagtatcgccggcttggaacgggaatttctgacgctattctgtcatgcgcgtttattgcgggtcttccgttggattggcaggagtggaagattcgacgaactcagaatgcaacggttttggttccgtgggatgattgttcgagttcgacgttttcgtttgagaatctggtgcttgatgcgttggaagaagaggttcgaaatctcaatctcttcttgcaacaccactcccgcaaataa
position 636
XM_057266820.1 - Penicillium waksmanii - NCBI
Arabidopsis thaliana uncharacterized protein (AT2G18970), mRNA. (531 bp)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA tccaatctcactcaaaatctcctccatgttcatctcttctccacctggcaaaagcttctgcaattccttcaatctcttcttgatctctcctccttcttcttcttcgtcgctgtcttggtgtttttctccaccttgtctcttgctcgatctttctagaatctcggaaggagaactactagtgctaattggatcatcataaggggaagataatagcttctgttgcaagaaacggctccacgcgaattcttgagcagacaatgcgaaagccatgtctacttcatgtttcacgggttcttgtttggttggagagaaaagactcgctttctcttgtttataatttgcctctccatgtgaaatttgtttgcttcgtcggaactct...
position 70
Synonym: F19F24.17; F19F24_17
NM_127454.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Belonocnema kinseyi uncharacterized LOC117172993 (LOC117172993), transcript variant X1, mRNA. (617 bp)
LOC117172993" /protein_id="XP_033217224.1" /db_xref="GeneID:117172993" /translation="MSTGAGMGGGIGGGTGGGYGAPASTTATKAAAPKKDEDIITTMKHKVTESTMYRHVRHPIDHLGCKHHLKKKGCRVHKKRPPRAPMGGGMEGGMAGGGMMAGGMG" ORIGIN // gcggcggttaacgcgtcaaggattatccgtcctcggtagctttgcttgagaattgagagggttaacctgcccgaaggatttcttcaatctcttcttgttcagtttaaatttttatttttttccgaactgctacacagtaacgagggccaggaaagtaatcgagcaaggcaatgagatttgtagagatgtaggtgcacaagagttgggaacgacggcgacaggtatgagcacgggtgctggtatgggtggtggtattgggggtggtacagggggaggctatggagctcctgcatctactaccgcaactaaagccgcagctcccaaaaaggatgaggatatcattactacgatgaaacataaagtgacagaaagcactatgtacagacatgtacgccacc...
position 85
XM_033361333.1 - Belonocnema kinseyi - NCBI
PREDICTED: Beta vulgaris subsp. vulgaris hypothetical protein (LOC104894204), mRNA. (689 bp)
polyA_site 689 /gene="LOC104894204" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN // ggtggaaatattcttcatttcccaccgtcatacgacattatatatatacacacaacatttcatcaaaacatttaagcaatcacaatttcaggaagcctttaaatctcaaaacaatctcttctttcttcttaaagcttaacaaattaaaacaatctcttcttgtttcttcatagttttaagattttacaagtataaataaaaatggcatcaggaaacacaaattatgagagttcatgggcagatcagtgggacccacaaccagcttatgtaagccatgaaaatgaaagcaaaaacaagaagaagaataatgaatcaggaggaggtgcaaagaagaaagttgaagaagggcttaccaaaactaaagaagttgcttctactagtttcaagaaggtcaaacagggtacttctatgggtatcagttggatcaaagacaagtatcataagaccacccaaaaacattaaatcatcatattataaacttctttttatttcatgtta...
position 150
XM_010680384.4 - Beta vulgaris subsp. vulgaris - NCBI
Fusarium redolens Nitroreductase-like protein (BKA55DRAFT_527765), partial mRNA. (618 bp)
K., Riley,R., Lipzen,A., Henrissat,B., Kohler,A., Grigoriev,I.V., Martin,F.M. and Hacquard,S. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (05-APR-2021) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggccgctgaactctccgccaatctcttcttgcagttcgtcaagagccgacgaacctactaccccctctcaaagaaccttcccatctccacctctcgcatccaggagattgttaacgaggctgtcctgcatacccccacatcctttaactcccagtctaaccgtctggtcgtcctccacggcaccgagcatgagaagctgtgggacatcactattgacaccctgaagcctatcgtgcccgctgcgaactggacggtcactagtgataagctcgccttattcaagggcgccgctggtaccatcctcttcttcaatgatatcaccaccgtcgag...
position 21
XM_046188949.1 - Fusarium redolens - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (630 bp)
Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan atgatattggcaccagaatatgacctggatgatggtgtagaatacccaaccaaatcgaaatatagttgggcatataataagataccattgtcaagatctcaatggatgtatctattgattggacaatgtttggtatcaggtgtagttaacttctttgtcaatctcttcttgacatggttaatgtatccaagggatttaggtgcaaccatttcattctctggacaaataacatgtatattctcggacattatagttacatcctttgttctaccaacaataacagcaatcattgcttcattcttggtgacattcgatcttcgtagaggacaattcattcaaccaattgacgagagatggttaaagcatccattcctttcttgggtaccaactggtatcaatattaagatcattttgaagagagcagttatattcggagtgtttggagtatgtatatttgcacctccaa...
position 159
XM_012897855.1 - Acytostelium subglobosum LB1 - NCBI
Meira miltonrushii Isochorismatase hydrolase (FA14DRAFT_152158), partial mRNA. (618 bp)
caaaacttttgaggggcgctcaaatcttggagatcccagttttcacaactgaacaaaactcgaaagctcttggatcgacggtagacgttctcaagaaagatatcccagaaaattccacaatcgttgacaagacccgattcagtatggtattggacgatggaacaacagataaatggctacgcgatcacaaagttcaaaatgtgatgattgtcggaattgagagtcacgtatgcgtcttacaaacgacattggacttgctcaagaaaggcttcaacgttttcatcattcgtgatgcaatctcttcttgtaataaacaagaagttccacttgccatcgaaagaatgcgtttggctggcgctacaatcacaacatccgaaagcgctctgtttgaactgatgctagattcaaaacatccccatttcaaagctatcagtgggctaatcaagacggaaaaggacagtacaaaagccgctcttgaagcactcacatcacgtatttga
position 413
XM_025497511.1 - Meira miltonrushii - NCBI
Aspergillus costaricaensis CBS 115574 hypothetical protein (BO79DRAFT_277183), partial mRNA. (511 bp)
Creek, CA 94598-1698, USA atggatttccgcaacctatcattcactctcctcctgctatccgctacagtcatgttatatttcaggactctactagcgcatcccatctacatgattagcacccctgcatcagtgcaaactccagactcagcgccaaccgacgccctcgccttcctcgacgagcccgtcttcagaccactggcatctcacatagcggacaacccatatccgtggcgtgataaacgtccattccaggagaccaattttgcgttactcatgggtgctgtccaatctcttcttgaggctgaggttgacgagggagagggtggtgtgagtttgaatgagagctatgggcaacaggatggcattgagagtaactcgtccgagacatattttctctgggctggggaagatgagaagtggtcttgcgcttagcaaaagcgctcagaggagttgagaaagtgaagatggtccttcgagacctgggattgtgagaagttcatttttggaaagtgggtttaaaacccactat
position 268
XM_025687799.1 - Aspergillus costaricaensis CBS 115574 - NCBI
PREDICTED: Rhodamnia argentea U-box domain-containing protein 7-like (LOC115752846), mRNA. (560 bp)
ttcctcaggaacaaggagttgatattagctgccggagtcgttccgcttctccaggaaatgacatccaaccatgactctcatccatcagcaacggctctatatctgaatctttcctgccttgaagatgccaagcccgtactaggcttgagtcaggctgtaccctttcttacccagcttcttaaagatgaaactgcacctcagtgcaagcttgatgctattcacgccctttacaatctctccacctaccatgacaatattggatacctgccttcggcaggcattatcagtggccttcaatctcttcttgcagatctagtgaccaaatgtggacagaaaagtcaatagctgtccttatgaatttagat
position 490
XM_048275127.1 - Rhodamnia argentea - NCBI
Polysphondylium pallidum PN500 hypothetical protein partial mRNA. (579 bp)
P., Noegel,A.A., Felder,M. and Platzer,M. TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Genome Analysis, Fritz Lipmann Institute, Beutenbergstr. 11, Jena 07745, Germany atgaaataccaaagattcatagaaacatttcatatctatttggttggaatcgagatgtctgttggacattttacaattgaaggtaaaatatacagtagaacagaagaacaatctcttcttgcaaaacaagagatacaacaacaagtgaaagtggccatcaatgaattcagtcatatcaatcatttggtgatttgtgattcaatgcaagagggtagagacgacttcaatcagatcaatgcagacagcaatcatacaaaatctaaaaactatatctttgcacttgactatttggagtttgtcgagcaacttagagttactagagaatcagcaaatcagaagtttgatatccatctcaaggtggatcaagatcaatcaaaagacattgctgaaaaagacaatatctgcgacagtgatgacaatg...
position 109
XM_020575709.1 - Heterostelium album PN500 - NCBI
Necator americanus uncharacterized protein (RB195_014921), partial mRNA. (579 bp)
taccggttttattcgtgtatccactttctgaggactgcgtgttaccaacctgacgcacggaaacaaagacgcgaaggagtcatactggtactactagtctttccttggattttgacagctgtgtttactttcggatcaatagcacttggttgctacaagagatataatcgtttcgcgttaatatacacttacagctgctcccattgcgacgttataccagggatatcgttcactgacgtgaacttttacggtggacaagctttaccctcaattcatggcgctatccagcaaagacaatctcttcttgatgctcgacttgcattccaatttatcgttatatgcctctctcaatacctcgctgcattgctcttctacattgttccgaagatgagcgcaggtgctgactggggagttctggtcacaaacagtattggttcgttttaa
position 430
Synonym: Necator_chrV.g19713
XM_064205395.1 - Necator americanus (New World hookworm) - NCBI
PREDICTED: Syngnathus acus prefoldin 5 (pfdn5), mRNA. (612 bp)
gttttagtcgatgtgggaacaggatattatgttgaaaagaatgtagcagattccaaggcattcttcaaacgaaaactagatttcctgacaaagcaaattgagaaaattcagcccgcccttcaggaaaaacatgccatgaaacaagctgtcattgaagtcatgaatgtgaagatccaacagctacaacagagtaaacaggcttccagcaccaaggcttaattgtgacaacacttaaatgaatgctttttgtgtgtgtgaaaaagaactgtaaaatgtcctgcactgacctttatacaatctcttcttgcataatttggaaataaagggttagtgaacattaa
position 566
XM_037252075.1 - Syngnathus acus (greater pipefish) - NCBI
PREDICTED: Prosopis cineraria chitin-binding lectin 1-like (LOC129284393), mRNA. (726 bp)
id="XP_054775833.1" /db_xref="GeneID:129284393" /translation="MTKKVTTMKLHVNLQCVKCYKKVKNVLCKFPQIQDQKFDEKENIVTIKVVCCSPEKIMDQLCRKGCGAIKCIEKVPCKPPTLPPTLCCDSCCECWHDGPCFEPKPRVPDRTCCVPCHDGRPCRPCFERCCRPPPCYEGYFYARPVYDSYGGGQPCYVSRCGQYVSEDNVTGCTIM" ORIGIN // tctttgctttcttccacaccattaccgttattgtcactttcaatctcttcttgcatcattttcatctctcgcatatctgagctcgatttcctcgtcattcagccatgactaaaaaggtgacaacaatgaagctccatgttaatctccagtgtgtgaaatgctacaagaaggtcaagaatgttctctgtaaattcccacaaattcaagaccagaaattcgatgagaaggagaacattgtgacgattaaagtggtgtgctgtagcccagagaagattatggatcagctttgccgtaaaggttgtggcgccattaagtgcatcgaaaaagtcccatgtaagccaccaactctgc...
position 41
XM_054919858.1 - Prosopis cineraria - NCBI
Necator americanus uncharacterized protein (RB195_014921), partial mRNA. (591 bp)
Zhan,B., Aroian,R.V., Pafco,B. and Schwarz,E.M. TITLE Direct Submission JOURNAL Submitted (21-AUG-2023) Molecular Biology and Genetics, Cornell University, Biotechnology Bldg., 526 Campus Road, Ithaca, NY 14853, USA atggtcgtcggctatacagtcatagtcatcagcgtttaccgtaatcgtagaattcatggcgctatccagcaaagacaatctcttcttgatgctcgacttgcattccaatttatcgttatatgcctctctcaatacctcgctgcattgctcttctacattgttccgaagatgagcgcaggtgctgactggggagttctggtcacaaacagtattgttatggaacaacagacatctcaaaagtcgctgccgtcagtgtcaacgcttctgtttcgcgacattttgtggtccggtaacggtcgcagcggttgtgatgctgagctgcagttaggaaagctttctggtttcactcccgaaaaagtggagctcattgtgctccacattcat...
position 76
Synonym: Necator_chrV.g19713
XM_064205394.1 - Necator americanus (New World hookworm) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/comp%3acaagaagagattg
lang : en | div : | spe : | query_string : comp:caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.079 | 0.079 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=(nt:caatctcttcttg)?to=0&format=json
0.426 | 0.347 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=(nt:caatctcttcttg)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.434 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]