ver.2
Help
|
Advanced search
|
English
旧バージョン
2021-01-16 23:57:26, GGRNA : RefSeq release 203 (Nov, 2020)
Summary:
Results:
検索語に色がつきます。重なると色が濃く表示されます。
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC003688.1, AJ011497.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185022.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2;
claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.2 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185023.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2;
claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.2 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
is encoded by transcript variant 3" /codon_start=1 /product="claudin-19 isoform c" /protein_id="NP_001172046.1" /db_xref="CCDS:CCDS53306.1" /db_xref="GeneID:149461" /db_xref="HGNC:HGNC:2040" /db_xref="MIM:610036" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGMNLAQPCSWAGPQLAWPCWAAPSSAAHARSQRDPTAAHSPIGLDPLLLPESTSELRLPWPAPHPVAPLPSIQPASQHPGQGHWGIGWA" misc_feature 183..>590 /gene="CLDN19" /gene_synonym="HOMG5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
ens claudin 15 (CLDN15), transcript variant 1, mRNA. ACCESSION NM_001185080 VERSION NM_001185080.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK056103.1 and DB158141.1. On Aug 13, 2020 this sequence version replaced NM_001185080.1. Summary: This gene encodes a member of the claudin family. Claudins...
This record has been curated by NCBI staff. The reference sequence was derived from AK312515.1, AK075405.1 and AA973123.1. On Aug 13, 2020 this sequence version replaced NM_001171095.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5'...
sapiens claudin 4 (CLDN4), mRNA. ACCESSION NM_001305 VERSION NM_001305.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC093168.3. On Apr 15, 2020 this sequence version replaced NM_001305.4. Summary: The protein encoded by this intronless gene belongs to the claudin family. Claudins are...
human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 1453) AUTHORS Kitano T, Kitajiri SI, Nishio SY and Usami SI. TITLE Detailed Clinical Features of Deafness Caused by a Claudin-14 Variant JOURNAL Int J Mol Sci 20 (18), E4579 (2019) PUBMED 31527509 REMARK GeneRIF: This report indicated that claudin-14 is essential for maintaining the inner ear environment and suggested the possible phenotypic expansion of DFNB29. This is the first report of a patient with a tight junction variant receiving a cochlear implantation. Publication...
Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK055855.1, BG697724.1, DB544708.1 and AL139376.17. On Aug 14, 2020 this sequence version replaced NM_182848.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK055855.1, BG697724.1, DB544708.1 and AL139376.17. On Aug 13, 2020 this sequence version replaced NM_001160100.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
specific role clnd16 in tau pathology REFERENCE 5 (bases 1 to 3319) AUTHORS Arcidiacono T, Simonini M, Lanzani C, Citterio L, Salvi E, Barlassina C, Spotti D, Cusi D, Manunta P and Vezzoli G. TITLE Claudin-14 Gene Polymorphisms and Urine Calcium Excretion JOURNAL Clin J Am Soc Nephrol 13 (10), 1542-1549 (2018) PUBMED 30232134 REMARK GeneRIF: No significant associations were found among claudin-16 and claudin-19 single-nucleotide polymorphisms and calcium excretion and between claudin-14, claudin-16, and claudin-19 single-nucleotide polymorphisms and stones. REFERENCE 6 (bases 1 to 3319)...
specific role clnd16 in tau pathology REFERENCE 5 (bases 1 to 3486) AUTHORS Arcidiacono T, Simonini M, Lanzani C, Citterio L, Salvi E, Barlassina C, Spotti D, Cusi D, Manunta P and Vezzoli G. TITLE Claudin-14 Gene Polymorphisms and Urine Calcium Excretion JOURNAL Clin J Am Soc Nephrol 13 (10), 1542-1549 (2018) PUBMED 30232134 REMARK GeneRIF: No significant associations were found among claudin-16 and claudin-19 single-nucleotide polymorphisms and calcium excretion and between claudin-14, claudin-16, and claudin-19 single-nucleotide polymorphisms and stones. REFERENCE 6 (bases 1 to 3486)...
membrane protein GENX-3745; claudin domain containing 1 protein; claudin domain-containing protein 1" /codon_start=1 /product="claudin domain-containing protein 1 isoform d" /protein_id="NP_001035290.1" /db_xref="CCDS:CCDS43116.1" /db_xref="GeneID:56650" /db_xref="HGNC:HGNC:1322" /translation="MGESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA" misc_feature <177..464 /gene="CLDND1" /gene_synonym="C3orf4; GENX-3745; Z38" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion decreases in presence of cerebellar hemorrhage JOURNAL J Neurosci Res 95 (10), 2051-2058 (2017) PUBMED 28244141 REMARK GeneRIF: suggest that the transient decrease of CLDND1 after cerebellar hemorrhage is responsible for low-molecular-weight selective vascular hyperpermeability REFERENCE 5 (bases 1 to 2054) AUTHORS Matsuoka H, Shima A, Uda A, Ezaki H and Michihara A. TITLE The retinoic acid receptor-related orphan receptor alpha positively regulates tight junction protein claudin domain-containing 1 mRNA...
A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion decreases in presence of cerebellar hemorrhage JOURNAL J Neurosci Res 95 (10), 2051-2058 (2017) PUBMED 28244141 REMARK GeneRIF: suggest that the transient decrease of CLDND1 after cerebellar hemorrhage is responsible for low-molecular-weight selective vascular hyperpermeability REFERENCE 5 (bases 1 to 2061) AUTHORS Matsuoka H, Shima A, Uda A, Ezaki H and Michihara A. TITLE The retinoic acid receptor-related orphan receptor alpha positively regulates tight junction protein claudin domain-containing 1 mRNA...
A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion decreases in presence of cerebellar hemorrhage JOURNAL J Neurosci Res 95 (10), 2051-2058 (2017) PUBMED 28244141 REMARK GeneRIF: suggest that the transient decrease of CLDND1 after cerebellar hemorrhage is responsible for low-molecular-weight selective vascular hyperpermeability REFERENCE 5 (bases 1 to 2005) AUTHORS Matsuoka H, Shima A, Uda A, Ezaki H and Michihara A. TITLE The retinoic acid receptor-related orphan receptor alpha positively regulates tight junction protein claudin domain-containing 1 mRNA...
A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion decreases in presence of cerebellar hemorrhage JOURNAL J Neurosci Res 95 (10), 2051-2058 (2017) PUBMED 28244141 REMARK GeneRIF: suggest that the transient decrease of CLDND1 after cerebellar hemorrhage is responsible for low-molecular-weight selective vascular hyperpermeability REFERENCE 5 (bases 1 to 2317) AUTHORS Matsuoka H, Shima A, Uda A, Ezaki H and Michihara A. TITLE The retinoic acid receptor-related orphan receptor alpha positively regulates tight junction protein claudin domain-containing 1 mRNA...
sapiens claudin 17 (CLDN17), mRNA. ACCESSION NM_012131 VERSION NM_012131.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AP000884.1 and BC101503.1. On May 17, 2019 this sequence version replaced NM_012131.2. Summary: This gene encodes a member of the claudin family. Claudins are integral...
CH471065.1. On or before Oct 4, 2007 this sequence version replaced XM_927777.1, XM_938396.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent...function of claudins JOURNAL Biochim. Biophys. Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 4 (bases 1 to 690) AUTHORS Katoh M and Katoh M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family...
Jun 9, 2010 this sequence version replaced XM_001714660.1, XM_001716940.1, XM_001716970.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent...function of claudins JOURNAL Biochim. Biophys. Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 3 (bases 1 to 663) AUTHORS Katoh M and Katoh M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family...
s claudin 15 (CLDN15), transcript variant 2, mRNA. ACCESSION NM_014343 VERSION NM_014343.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ245738.1 and AK056103.1. On Jun 2, 2019 this sequence version replaced NM_014343.2. Summary: This gene encodes a member of the claudin family. Claudins...
LOCUS NM_001195081 995 bp mRNA linear PRI 05-JUL-2020 DEFINITION Homo sapiens claudin 34 (CLDN34), mRNA. ACCESSION NM_001195081 XM_002343807 XM_002348146 VERSION NM_001195081.2 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC002365.1. On May 17, 2019 this sequence version...
inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 723..1151 /gene="TMEM235" /gene_synonym="ARGM1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 832..969 /gene="TMEM235" /gene_synonym="ARGM1" /inference="alignment:Splign:2.1.0"...GC and Manson FD. TITLE The cataract-associated protein TMEM114, and TMEM235, are glycosylated transmembrane proteins that are distinct from claudin family members JOURNAL FEBS Lett. 585 (14), 2187-2192 (2011) PUBMED 21689651 REMARK GeneRIF: Data demonstrate that TMEM114, and the closely related...
sapiens claudin 20 (CLDN20), mRNA. ACCESSION NM_001001346 VERSION NM_001001346.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC020838.1 and AL139101.13. On Jun 5, 2010 this sequence version replaced NM_001001346.2. Summary: This gene encodes a member of the claudin family. Claudins are...
inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 723..1232 /gene="TMEM235" /gene_synonym="ARGM1" /note="PMP-22/EMP/MP20/Claudin tight junction; Region: Claudin_2; pfam13903" /db_xref="CDD:290614" misc_feature 762..764 /gene="TMEM235" /gene_synonym="ARGM1" /note="N-linked...GC and Manson FD. TITLE The cataract-associated protein TMEM114, and TMEM235, are glycosylated transmembrane proteins that are distinct from claudin family members JOURNAL FEBS Lett. 585 (14), 2187-2192 (2011) PUBMED 21689651 REMARK GeneRIF: Data demonstrate that TMEM114, and the closely related...
was derived from DA743944.1, AK075405.1 and AA973123.1. This sequence is a reference standard in the RefSeqGene project. On Jun 2, 2019 this sequence version replaced NM_020384.3. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated...
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF177340.1, AK075405.1 and AA973123.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region...
human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 1257) AUTHORS Kitano T, Kitajiri SI, Nishio SY and Usami SI. TITLE Detailed Clinical Features of Deafness Caused by a Claudin-14 Variant JOURNAL Int J Mol Sci 20 (18), E4579 (2019) PUBMED 31527509 REMARK GeneRIF: This report indicated that claudin-14 is essential for maintaining the inner ear environment and suggested the possible phenotypic expansion of DFNB29. This is the first report of a patient with a tight junction variant receiving a cochlear implantation. Publication...
claudin 9 (CLDN9), mRNA. ACCESSION NM_020982 XM_001715692 VERSION NM_020982.4 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK091002.1, BC051870.1 and AI791760.1. On Nov 23, 2018 this sequence version replaced NM_020982.3. Summary: This gene encodes a member of the claudin family. Claudins...
human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 1514) AUTHORS Kitano T, Kitajiri SI, Nishio SY and Usami SI. TITLE Detailed Clinical Features of Deafness Caused by a Claudin-14 Variant JOURNAL Int J Mol Sci 20 (18), E4579 (2019) PUBMED 31527509 REMARK GeneRIF: This report indicated that claudin-14 is essential for maintaining the inner ear environment and suggested the possible phenotypic expansion of DFNB29. This is the first report of a patient with a tight junction variant receiving a cochlear implantation. Publication...
codon_start=1 /product="claudin-6 precursor" /protein_id="NP_067018.2" /db_xref="CCDS:CCDS10488.1" /db_xref="GeneID:9074" /db_xref="HGNC:HGNC:2048" /db_xref="MIM:615798" /translation="MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV" sig_peptide 57..119 /gene="CLDN6" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 69..566 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
id="NP_001161431.1" /db_xref="GeneID:130733" /db_xref="HGNC:HGNC:28517" /translation="MAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV" misc_feature <308..580 /gene="TMEM178A" /gene_synonym="TMEM178" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833" exon 411..1364 /gene="TMEM178A" /gene_synonym="TMEM178" /inference="alignment:Splign:2.1.0" regulatory 1341..1346 /regulatory_class="polyA_signal_sequence" /gene="TMEM178A" /gene_synonym="TMEM178" /note="hexamer: ATTAAA" polyA_site 1364 /...
Homo sapiens claudin 12 (CLDN12), transcript variant 3, mRNA. ACCESSION NM_012129 VERSION NM_012129.5 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC006153.2. On May 31, 2019 this sequence version replaced NM_012129.4. Summary: This gene encodes a member of the claudin family. Claudins are integral...
sapiens claudin 12 (CLDN12), transcript variant 2, mRNA. ACCESSION NM_001185073 VERSION NM_001185073.3 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC006153.2. On May 31, 2019 this sequence version replaced NM_001185073.2. Summary: This gene encodes a member of the claudin family. Claudins are integral...
iens claudin 12 (CLDN12), transcript variant 1, mRNA. ACCESSION NM_001185072 VERSION NM_001185072.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC006153.2. On Nov 24, 2018 this sequence version replaced NM_001185072.2. Summary: This gene encodes a member of the claudin family. Claudins...
is encoded by transcript variant 1" /codon_start=1 /product="claudin-19 isoform a" /protein_id="NP_683763.2" /db_xref="CCDS:CCDS471.1" /db_xref="GeneID:149461" /db_xref="HGNC:HGNC:2040" /db_xref="MIM:610036" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV" misc_feature 183..719 /gene="CLDN19" /gene_synonym="HOMG5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833"...
human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 1784) AUTHORS Kitano T, Kitajiri SI, Nishio SY and Usami SI. TITLE Detailed Clinical Features of Deafness Caused by a Claudin-14 Variant JOURNAL Int J Mol Sci 20 (18), E4579 (2019) PUBMED 31527509 REMARK GeneRIF: This report indicated that claudin-14 is essential for maintaining the inner ear environment and suggested the possible phenotypic expansion of DFNB29. This is the first report of a patient with a tight junction variant receiving a cochlear implantation. Publication...
been curated by NCBI staff. The reference sequence was derived from DA629490.1, AY358707.1, AL049977.1 and AW235670.1. This sequence is a reference standard in the RefSeqGene project. On May 17, 2019 this sequence version replaced NM_199328.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC000082.4, AK124019.1 and BC032363.1. On Jun 2, 2019 this sequence version replaced NM_001363066.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in...
gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2" /protein_id="NP_689566.1" /db_xref="CCDS:CCDS12829.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL" misc_feature 445..507 /gene="CLDND2" /note="propagated from UniProtKB/Swiss-Prot (Q8NHS1.1); transmembrane region" misc_feature 454..858 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="...
prostate.1 protein homolog" /codon_start=1 /product="claudin-3" /protein_id="NP_001297.1" /db_xref="CCDS:CCDS5559.1" /db_xref="GeneID:1365" /db_xref="HGNC:HGNC:2045" /db_xref="MIM:602910" /translation="MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV" misc_feature 228..722 /gene="CLDN3" /gene_synonym="C7orf1; CPE-R2; CPETR2; HRVP1; RVP1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 1974) AUTHORS Kitano T, Kitajiri SI, Nishio SY and Usami SI. TITLE Detailed Clinical Features of Deafness Caused by a Claudin-14 Variant JOURNAL Int J Mol Sci 20 (18), E4579 (2019) PUBMED 31527509 REMARK GeneRIF: This report indicated that claudin-14 is essential for maintaining the inner ear environment and suggested the possible phenotypic expansion of DFNB29. This is the first report of a patient with a tight junction variant receiving a cochlear implantation. Publication...
CDS 258..698 /gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /codon_start=1 /product="claudin-10 isoform X4" /protein_id="XP_024305200.1" /db_xref="GeneID:9071" /db_xref="HGNC:HGNC:2033" /db_xref="MIM:617579" /translation="MIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV" misc_feature <258..548 /gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" variation 258 /gene="CLDN10" /gene_synonym...
misc_feature 1368..1430 /gene="CACNG6" /note="propagated from UniProtKB/Swiss-Prot (Q9BXT2.1); transmembrane region" misc_feature 1401..>1571 /gene="CACNG6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 1573..2288 /gene="CACNG6" /inference="alignment:Splign:2.1.0" regulatory 2268..2273 /regulatory_class="polyA_signal_sequence" /gene="CACNG6" /note="hexamer: ATTAAA" polyA_site 2288 /gene="CACNG6" /note="major polyA site" ORIGIN // REFERENCE 1 (bases 1 to 2288) AUTHORS Guan F, Zhang T, Liu X, Han W, Lin H, Li L, Chen G and Li T. TITLE...
translation="MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT" misc_feature 1401..>1652 /gene="CACNG6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 1573..1647 /gene="CACNG6" /inference="alignment:Splign:2.1.0" exon 1648..2363 /gene="CACNG6" /inference="alignment:Splign:2.1.0" regulatory 2343..2348 /regulatory_class="polyA_signal_sequence" /gene="CACNG6" /note="hexamer: ATTAAA"...
to inhibit the growth and invasion of HCC cells through PI3K/AKT and epithelial-mesenchymal transition (EMT) signaling, and promote apoptosis by activating the cytochrome-c/caspase signaling pathway. REFERENCE 2 (bases 1 to 2948) AUTHORS Kim YE, Choi S, Kim JO and Kim KK. TITLE RBFOX3 regulates Claudin-1 expression in human lung tissue via attenuation of proteasomal degradation JOURNAL Biosci Rep 37 (1) (2017) PUBMED 28126724 REMARK GeneRIF: In human lung tissue, Claudin-1 is higher in RBFOX3-positive cells than in RBFOX3-negative cells. Immunostaining and mRNA quantification revealed that...
s claudin 5 (CLDN5), transcript variant 2, mRNA. ACCESSION NM_003277 VERSION NM_003277.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB023636.1 and AK092561.1. On Jun 2, 2019 this sequence version replaced NM_003277.3. Summary: This gene encodes a member of the claudin family. Claudins...
to inhibit the growth and invasion of HCC cells through PI3K/AKT and epithelial-mesenchymal transition (EMT) signaling, and promote apoptosis by activating the cytochrome-c/caspase signaling pathway. REFERENCE 2 (bases 1 to 3070) AUTHORS Kim YE, Choi S, Kim JO and Kim KK. TITLE RBFOX3 regulates Claudin-1 expression in human lung tissue via attenuation of proteasomal degradation JOURNAL Biosci Rep 37 (1) (2017) PUBMED 28126724 REMARK GeneRIF: In human lung tissue, Claudin-1 is higher in RBFOX3-positive cells than in RBFOX3-negative cells. Immunostaining and mRNA quantification revealed that...
to inhibit the growth and invasion of HCC cells through PI3K/AKT and epithelial-mesenchymal transition (EMT) signaling, and promote apoptosis by activating the cytochrome-c/caspase signaling pathway. REFERENCE 2 (bases 1 to 3043) AUTHORS Kim YE, Choi S, Kim JO and Kim KK. TITLE RBFOX3 regulates Claudin-1 expression in human lung tissue via attenuation of proteasomal degradation JOURNAL Biosci Rep 37 (1) (2017) PUBMED 28126724 REMARK GeneRIF: In human lung tissue, Claudin-1 is higher in RBFOX3-positive cells than in RBFOX3-negative cells. Immunostaining and mRNA quantification revealed that...
to inhibit the growth and invasion of HCC cells through PI3K/AKT and epithelial-mesenchymal transition (EMT) signaling, and promote apoptosis by activating the cytochrome-c/caspase signaling pathway. REFERENCE 2 (bases 1 to 3233) AUTHORS Kim YE, Choi S, Kim JO and Kim KK. TITLE RBFOX3 regulates Claudin-1 expression in human lung tissue via attenuation of proteasomal degradation JOURNAL Biosci Rep 37 (1) (2017) PUBMED 28126724 REMARK GeneRIF: In human lung tissue, Claudin-1 is higher in RBFOX3-positive cells than in RBFOX3-negative cells. Immunostaining and mRNA quantification revealed that...
Data Export:
下記より最大10000件まで検索結果を取得できます。
Debug Info:
Redirect URI : http://ggrna.dbcls.jp/ja/hs/claudin
lang : ja |
div : |
spe : hs |
query_string : claudin |
format : html |
download :
0.000 | 0.000 | search_start;
0.085 | 0.085 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Homo sapiens (human)?to=0&format=json
0.308 | 0.223 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Homo sapiens (human)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.314 | 0.006 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]