GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 16:27:30, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_079374                863 bp    mRNA    linear   INV 26-DEC-2023
DEFINITION  Drosophila melanogaster ADP ribosylation factor-like 1 (Arl1),
            mRNA.
ACCESSION   NM_079374
VERSION     NM_079374.4
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 863)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 863)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 863)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 863)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 863)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 863)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 863)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 863)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 863)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 863)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 863)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 863)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 863)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 863)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 863)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (10-NOV-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 863)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 863)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 863)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 863)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 863)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   21 (bases 1 to 863)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-OCT-2015) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   22 (bases 1 to 863)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   23 (bases 1 to 863)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   24 (bases 1 to 863)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   25 (bases 1 to 863)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NT_037436).
            
            On Jan 16, 2013 this sequence version replaced NM_079374.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..863
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="3L"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..863
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="ADP ribosylation factor-like 1"
                     /map="72C1-72C1"
                     /db_xref="FLYBASE:FBgn0000115"
                     /db_xref="GeneID:39745"
     CDS             143..685
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="CG6025 gene product from transcript CG6025-RA;
                     CG6025-PA; Arl1-PA; arflike at 72A; Arf-like 1; Arf72A"
                     /codon_start=1
                     /product="ADP ribosylation factor-like 1"
                     /protein_id="NP_524098.2"
                     /db_xref="FLYBASE:FBpp0075272"
                     /db_xref="GeneID:39745"
                     /db_xref="FLYBASE:FBgn0000115"
                     /translation="
MGGVLSYFRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK"
     misc_feature    194..667
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="ADP ribosylation factor 1 (Arf1); Region: Arl1;
                     cd04151"
                     /db_xref="CDD:206718"
     misc_feature    209..232
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="G1 box; other site"
                     /db_xref="CDD:206718"
     misc_feature    order(215..235,272..274,281..283,347..349,515..520,
                     524..526,614..622)
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206718"
     misc_feature    order(215..220,230..232,242..244,278..301,365..367,
                     380..382)
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="putative GAP interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206718"
     misc_feature    245..292
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206718"
     misc_feature    order(281..295,308..310,338..340,350..352,368..370,
                     374..382)
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206718"
     misc_feature    281..283
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="G2 box; other site"
                     /db_xref="CDD:206718"
     misc_feature    order(287..292,329..331,377..382,386..388,482..484)
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="effector interaction site [active]"
                     /db_xref="CDD:206718"
     misc_feature    order(290..313,320..337)
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="interswitch region [active]"
                     /db_xref="CDD:206718"
     misc_feature    order(338..364,368..379)
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206718"
     misc_feature    338..349
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="G3 box; other site"
                     /db_xref="CDD:206718"
     misc_feature    515..526
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="G4 box; other site"
                     /db_xref="CDD:206718"
     misc_feature    614..622
                     /gene="Arl1"
                     /locus_tag="Dmel_CG6025"
                     /gene_synonym="72CDd; Arf; arf72A; Arf72A; arf[72A]; arl;
                     arl1; ARL1; ARL1_DROME; BcDNA:GM20805; CG 6025; CG6025;
                     dArl1; dARL1p; Dmel\CG6025; l(3)72Ae; l(3)72CDd; P25160"
                     /note="G5 box; other site"
                     /db_xref="CDD:206718"
ORIGIN      
aaccattctccagcccaaaaaaaagtgaaaacaagacttctgcgattttgtattaattgtagcaccacatacaattaactaggtttactaaacttaagcatttagaggcagcgccagcactagacaaagttcagccgtaatcatgggtggggtgctcagctactttcgcggactgctcggctcccgggagatgcgcatcttgatcctgggcctggacggcgccggcaagaccacgatcctctacagactgcaggtgggcgaggtggtcaccacgatacccaccatcggcttcaacgtggagcaggtcacctacaagaacctcaagttccaggtctgggatttgggcggacagacaagtattagaccttattggcgttgctactacagcaacacggacgcaatcatctatgtggtggactcggcggaccgggaccgcattggcatctccaaggacgagctgctgtacatgctgcgtgaggaggagctggccggcgcgatactggtcgtcctggcgaacaagcaggacatggacggatgcatgaccgtcgccgaggtccatcatgcgttaggactggagaacctaaagaaccgcacatttcaaatattcaaaacgtcggccaccaagggcgagggactcgaccaggccatggactggctgtccaacaccctgcagagtcgcaagtagatacttagccagtcctcagacccccagatccctgtgtaaaaaatgtgtgtccaaagcatcgccagctagggaacgtcaacagcttttttcaaattgcagattgcgcaaaaaatccacgaaccgaaagaaactttgtaataacttctagtaatataattattaaattataggattaaac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]