GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2019-12-10 19:04:32, GGRNA : RefSeq release 97 (Nov, 2019)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1944 bp)
DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. ACCESSION NM_001185023 VERSION NM_001185023.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
SEP-2019 DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. ACCESSION NM_001185022 VERSION NM_001185022.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ011497.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (1542 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.6 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 22 (CLDN22), mRNA. (2210 bp)
was derived from AC093844.3. On Aug 6, 2019 this sequence version replaced NM_001111319.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent...function of claudins JOURNAL Biochim. Biophys. Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 3 (bases 1 to 2210) AUTHORS Katoh M and Katoh M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family...
Synonym: CLDN21
NM_001111319.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 17 (CLDN17), mRNA. (1241 bp)
sapiens claudin 17 (CLDN17), mRNA. ACCESSION NM_012131 VERSION NM_012131.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AP000884.1 and BC101503.1. On May 17, 2019 this sequence version replaced NM_012131.2. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_012131.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 25 (CLDN25), mRNA. (690 bp)
CH471065.1. On or before Oct 4, 2007 this sequence version replaced XM_927777.1, XM_938396.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent...function of claudins JOURNAL Biochim. Biophys. Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 3 (bases 1 to 690) AUTHORS Katoh M and Katoh M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family...
NM_001101389.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 24 (CLDN24), mRNA. (663 bp)
Jun 9, 2010 this sequence version replaced XM_001714660.1, XM_001716940.1, XM_001716970.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent...function of claudins JOURNAL Biochim. Biophys. Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 3 (bases 1 to 663) AUTHORS Katoh M and Katoh M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family...
Synonym: CLDN21
NM_001185149.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 3, mRNA. (2932 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK312515.1, AK075405.1 and AA973123.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region...
NM_001171095.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 1, mRNA. (2961 bp)
was derived from DA743944.1, AK075405.1 and AA973123.1. This sequence is a reference standard in the RefSeqGene project. On Jun 2, 2019 this sequence version replaced NM_020384.3. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated...
NM_020384.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 34 (CLDN34), mRNA. (995 bp)
LOCUS NM_001195081 995 bp mRNA linear PRI 30-JUN-2019 DEFINITION Homo sapiens claudin 34 (CLDN34), mRNA. ACCESSION NM_001195081 XM_002343807 XM_002348146 VERSION NM_001195081.2 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC002365.1. On May 17, 2019 this sequence version...
NM_001195081.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 2, mRNA. (3163 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF177340.1, AK075405.1 and AA973123.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region...
NM_001171092.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 20 (CLDN20), mRNA. (1209 bp)
sapiens claudin 20 (CLDN20), mRNA. ACCESSION NM_001001346 VERSION NM_001001346.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC020838.1 and AL139101.13. On Jun 5, 2010 this sequence version replaced NM_001001346.2. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_001001346.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 15 (CLDN15), transcript variant 2, mRNA. (1224 bp)
claudin 15 (CLDN15), transcript variant 2, mRNA. ACCESSION NM_014343 VERSION NM_014343.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ245738.1 and AK056103.1. On Jun 2, 2019 this sequence version replaced NM_014343.2. Summary: This gene encodes a member of the claudin family. Claudins...
NM_014343.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 9 (CLDN9), mRNA. (1583 bp)
claudin 9 (CLDN9), mRNA. ACCESSION NM_020982 XM_001715692 VERSION NM_020982.4 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK091002.1, BC051870.1 and AI791760.1. On Nov 23, 2018 this sequence version replaced NM_020982.3. Summary: This gene encodes a member of the claudin family. Claudins...
NM_020982.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 3 (CLDN3), mRNA. (1274 bp)
prostate.1 protein homolog" /codon_start=1 /product="claudin-3" /protein_id="NP_001297.1" /db_xref="CCDS:CCDS5559.1" /db_xref="GeneID:1365" /db_xref="HGNC:HGNC:2045" /db_xref="MIM:602910" /translation="MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV" misc_feature 228..722 /gene="CLDN3" /gene_synonym="C7orf1; CPE-R2; CPETR2; HRVP1; RVP1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: C7orf1; CPE-R2; CPETR2; HRVP1; RVP1
NM_001306.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 6 (CLDN6), mRNA. (1366 bp)
codon_start=1 /product="claudin-6 precursor" /protein_id="NP_067018.2" /db_xref="CCDS:CCDS10488.1" /db_xref="GeneID:9074" /db_xref="HGNC:HGNC:2048" /db_xref="MIM:615798" /translation="MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV" sig_peptide 57..119 /gene="CLDN6" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 69..566 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_021195.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 12 (CLDN12), transcript variant 3, mRNA. (3490 bp)
Homo sapiens claudin 12 (CLDN12), transcript variant 3, mRNA. ACCESSION NM_012129 VERSION NM_012129.5 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC006153.2. On May 31, 2019 this sequence version replaced NM_012129.4. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_012129.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 12 (CLDN12), transcript variant 2, mRNA. (3494 bp)
sapiens claudin 12 (CLDN12), transcript variant 2, mRNA. ACCESSION NM_001185073 VERSION NM_001185073.3 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC006153.2. On May 31, 2019 this sequence version replaced NM_001185073.2. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001185073.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 15 (CLDN15), transcript variant 1, mRNA. (2145 bp)
DEFINITION Homo sapiens claudin 15 (CLDN15), transcript variant 1, mRNA. ACCESSION NM_001185080 VERSION NM_001185080.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK056103.1, DB158141.1 and AA514265.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins...
NM_001185080.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 11 (CLDN11), transcript variant 2, mRNA. (2445 bp)
ens claudin 11 (CLDN11), transcript variant 2, mRNA. ACCESSION NM_001185056 VERSION NM_001185056.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC008041.5 and DA258090.1. On Jun 2, 2019 this sequence version replaced NM_001185056.1. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: OSP; OTM
NM_001185056.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 5 (CLDN5), transcript variant 4, mRNA. (1384 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC000082.4, AK124019.1 and BC032363.1. On Jun 2, 2019 this sequence version replaced NM_001363066.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in...
Synonym: AWAL; BEC1; CPETRL1; TMDVCF; TMVCF
NM_001363066.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 8 (CLDN8), mRNA. (2092 bp)
been curated by NCBI staff. The reference sequence was derived from DA629490.1, AY358707.1, AL049977.1 and AW235670.1. This sequence is a reference standard in the RefSeqGene project. On May 17, 2019 this sequence version replaced NM_199328.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: HEL-S-79
NM_199328.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin domain containing 2 (CLDND2), mRNA. (974 bp)
product="claudin domain-containing protein 2" /protein_id="NP_689566.1" /db_xref="CCDS:CCDS12829.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL" misc_feature 445..507 /gene="CLDND2" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q8NHS1.1); transmembrane region" misc_feature 454..858 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region...
NM_152353.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 11 (CLDN11), transcript variant 1, mRNA. (2758 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DC328248.1, BC013577.1 and AC008041.5. On Jun 2, 2019 this sequence version replaced NM_005602.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: OSP; OTM
NM_005602.6 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 10 (CLDN10), transcript variant X4, mRNA. (922 bp)
CDS 258..698 /gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /codon_start=1 /product="claudin-10 isoform X4" /protein_id="XP_024305200.1" /db_xref="GeneID:9071" /db_xref="HGNC:HGNC:2033" /db_xref="MIM:617579" /translation="MIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV" misc_feature <258..548 /gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" variation 258 /gene="CLDN10" /gene_synonym...
Synonym: CPETRL3; HELIX; OSP-L; OSPL
XM_024449432.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 5 (CLDN5), transcript variant 2, mRNA. (1699 bp)
s claudin 5 (CLDN5), transcript variant 2, mRNA. ACCESSION NM_003277 VERSION NM_003277.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB023636.1 and AK092561.1. On Jun 2, 2019 this sequence version replaced NM_003277.3. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: AWAL; BEC1; CPETRL1; TMDVCF; TMVCF
NM_003277.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 4 (CLDN4), mRNA. (1859 bp)
The reference sequence was derived from BM768799.1, AK026651.1, BC000671.2 and AI560666.1. This sequence is a reference standard in the RefSeqGene project. On Sep 17, 2013 this sequence version replaced NM_001305.3. Summary: The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ...
Synonym: CPE-R; CPER; CPETR; CPETR1; hCPE-R; WBSCR8
NM_001305.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 12 (CLDN12), transcript variant 1, mRNA. (3533 bp)
iens claudin 12 (CLDN12), transcript variant 1, mRNA. ACCESSION NM_001185072 VERSION NM_001185072.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC006153.2. On Nov 24, 2018 this sequence version replaced NM_001185072.2. Summary: This gene encodes a member of the claudin family. Claudins...
NM_001185072.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 5 (CLDN5), transcript variant 3, mRNA. (1800 bp)
piens claudin 5 (CLDN5), transcript variant 3, mRNA. ACCESSION NM_001363067 XM_017028929 VERSION NM_001363067.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC000082.4. On Jun 2, 2019 this sequence version replaced NM_001363067.1. Summary: This gene encodes a member of the claudin family. Claudins are...
Synonym: AWAL; BEC1; CPETRL1; TMDVCF; TMVCF
NM_001363067.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 14 (CLDN14), transcript variant epsilon, mRNA. (1257 bp)
LOCUS NM_012130 1257 bp mRNA linear PRI 26-OCT-2019 DEFINITION Homo sapiens claudin 14 (CLDN14), transcript variant epsilon, mRNA. ACCESSION NM_012130 VERSION NM_012130.4 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...from UniProtKB/Swiss-Prot (O95500.1); transmembrane region" misc_feature 249..725 /gene="CLDN14" /gene_synonym="DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_feature 426..488 /gene="CLDN14" /gene_synonym="DFNB29" /experiment="experimental...
Synonym: DFNB29
NM_012130.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 19 (CLDN19), transcript variant 1, mRNA. (2841 bp)
is encoded by transcript variant 1" /codon_start=1 /product="claudin-19 isoform a" /protein_id="NP_683763.2" /db_xref="CCDS:CCDS471.1" /db_xref="GeneID:149461" /db_xref="HGNC:HGNC:2040" /db_xref="MIM:610036" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV" misc_feature 183..719 /gene="CLDN19" /gene_synonym="HOMG5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820"...
Synonym: HOMG5
NM_148960.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 14 (CLDN14), transcript variant 3, mRNA. (1469 bp)
LOCUS NM_001146077 1469 bp mRNA linear PRI 24-SEP-2019 DEFINITION Homo sapiens claudin 14 (CLDN14), transcript variant 3, mRNA. ACCESSION NM_001146077 VERSION NM_001146077.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...from UniProtKB/Swiss-Prot (O95500.1); transmembrane region" misc_feature 445..921 /gene="CLDN14" /gene_synonym="DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_feature 622..684 /gene="CLDN14" /gene_synonym="DFNB29" /experiment="experimental...
Synonym: DFNB29
NM_001146077.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (MFNG), transcript variant 3, non-coding RNA. (2024 bp)
is distinct from other glycosyltransferases, these proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. The protein encoded by this gene may control Notch signaling in claudin-low breast cancer. [provided by RefSeq, May 2018]. Transcript Variant: This variant (3) lacks an alternate internal exon, compared to variant 1. This variant is represented as non-coding because the use of the 5'-most supported translational start codon, as used in variant 1, renders the transcript a...
NR_029413.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens serine protease 2 (PRSS2), transcript variant 3, non-coding RNA. (735 bp)
REMARK GeneRIF: Data indicate association between polymorphism rs10273639 of the PRSS1-PRSS2 locus and pancreatitis development. REFERENCE 2 (bases 1 to 735) AUTHORS Avanthi SU, Ravi Kanth VV, Agarwal J, Lakhtakia S, Gangineni K, Rao GV, Reddy DN and Talukdar R. TITLE Association of claudin2 and PRSS1-PRSS2 polymorphisms with idiopathic recurrent acute and chronic pancreatitis: A case-control study from India JOURNAL J. Gastroenterol. Hepatol. 30 (12), 1796-1801 (2015) PUBMED 26110235 REMARK GeneRIF: evaluated the association of claudin2 and PRSS1-PRSS2 polymorphisms with idiopathic recurrent...
Synonym: TRY2; TRY8; TRYP2
NR_130149.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 1 (CLDN1), mRNA. (3446 bp)
growth and induces the epithelial-mesenchymal transition in non-small-cell lung cancer cells by upregulating claudin-1. REFERENCE 5 (bases 1 to 3446) AUTHORS Akimoto T, Takasawa A, Takasawa K, Aoyama T, Murata M, Osanai M, Saito T and Sawada N. TITLE Estrogen/GPR30 Signaling Contributes to the Malignant Potentials of ER-Negative Cervical Adenocarcinoma via Regulation of Claudin-1 Expression JOURNAL Neoplasia 20 (10), 1083-1093 (2018) PUBMED 30227306 REMARK GeneRIF: CLaudin-1 contributes to malignant potentials of cervical adenocarcinoma cells.Claudin-1 expression is regulated by GPR30...
Synonym: CLD1; ILVASC; SEMP1
NM_021101.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 14 (CLDN14), transcript variant gamma, mRNA. (1514 bp)
LOCUS NM_001146078 1514 bp mRNA linear PRI 26-OCT-2019 DEFINITION Homo sapiens claudin 14 (CLDN14), transcript variant gamma, mRNA. ACCESSION NM_001146078 VERSION NM_001146078.3 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...from UniProtKB/Swiss-Prot (O95500.1); transmembrane region" misc_feature 506..982 /gene="CLDN14" /gene_synonym="DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_feature 683..745 /gene="CLDN14" /gene_synonym="DFNB29" /experiment="experimental...
Synonym: DFNB29
NM_001146078.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 10 (CLDN10), transcript variant a_v1, mRNA. (2601 bp)
Homo sapiens claudin 10 (CLDN10), transcript variant a_v1, mRNA. ACCESSION NM_001160100 VERSION NM_001160100.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA636757.1, AK055855.1, BG697724.1 and DB544708.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane...
Synonym: CPETRL3; HELIX; OSP-L; OSPL
NM_001160100.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 10 (CLDN10), transcript variant b, mRNA. (2466 bp)
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA133712.1, BC010920.1, AK055855.1, BG697724.1, DB544708.1 and AL139376.17. On Nov 22, 2018 this sequence version replaced NM_006984.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: CPETRL3; HELIX; OSP-L; OSPL
NM_006984.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 10 (CLDN10), transcript variant X2, mRNA. (1065 bp)
HELIX; OSP-L; OSPL" /codon_start=1 /product="claudin-10 isoform X2" /protein_id="XP_011519436.1" /db_xref="GeneID:9071" /db_xref="HGNC:HGNC:2033" /db_xref="MIM:617579" /translation="MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDENLANDRPCKLPSLCMRKINKLWLLFMLEKGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV" misc_feature 74..691 /gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: CPETRL3; HELIX; OSP-L; OSPL
XM_011521134.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 5 (CLDN5), transcript variant 1, mRNA. (2332 bp)
DEFINITION Homo sapiens claudin 5 (CLDN5), transcript variant 1, mRNA. ACCESSION NM_001130861 VERSION NM_001130861.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK092561.1, AK124019.1 and BU688528.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: AWAL; BEC1; CPETRL1; TMDVCF; TMVCF
NM_001130861.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens calcium voltage-gated channel auxiliary subunit gamma 5 (CACNG5), transcript variant 1, mRNA. (10576 bp)
misc_feature 259..321 /gene="CACNG5" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9UF02.2); transmembrane region" misc_feature 262..822 /gene="CACNG5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_feature 544..606 /gene="CACNG5" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9UF02.2); transmembrane region" misc_feature 622..684 /gene="CACNG5" /experiment="experimental evidence, no additional details recorded...
NM_145811.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 10 (CLDN10), transcript variant a, mRNA. (2658 bp)
been curated by NCBI staff. The reference sequence was derived from DA636757.1, AK055855.1, BG697724.1 and DB544708.1. This sequence is a reference standard in the RefSeqGene project. On May 12, 2009 this sequence version replaced NM_182848.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: CPETRL3; HELIX; OSP-L; OSPL
NM_182848.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 10 (CLDN10), transcript variant X3, mRNA. (1240 bp)
HELIX; OSP-L; OSPL" /codon_start=1 /product="claudin-10 isoform X3" /protein_id="XP_016876333.1" /db_xref="GeneID:9071" /db_xref="HGNC:HGNC:2033" /db_xref="MIM:617579" /translation="MSRAQIWALVSGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVAENLANDRPCKLPSLCMRKINKLWLLFMLEKGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV" misc_feature 270..866 /gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref...
Synonym: CPETRL3; HELIX; OSP-L; OSPL
XM_017020844.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens calcium voltage-gated channel auxiliary subunit gamma 3 (CACNG3), mRNA. (1917 bp)
misc_feature 436..1008 /gene="CACNG3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_feature 442..504 /gene="CACNG3" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O60359.1); transmembrane region" misc_feature 730..792 /gene="CACNG3" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O60359.1); transmembrane region" misc_feature 823..885 /gene="CACNG3" /experiment="experimental evidence, no additional details recorded...
NM_006539.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin domain containing 1 (CLDND1), transcript variant 7, mRNA. (1883 bp)
variant 7; claudin domain containing 1 protein; claudin domain-containing protein 1; membrane protein GENX-3745" /codon_start=1 /product="claudin domain-containing protein 1 isoform d" /protein_id="NP_001035290.1" /db_xref="CCDS:CCDS43116.1" /db_xref="GeneID:56650" /db_xref="HGNC:HGNC:1322" /translation="MGESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA" misc_feature <341..628 /gene="CLDND1" /gene_synonym="C3orf4; GENX-3745; Z38" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: C3orf4; GENX-3745; Z38
NM_001040200.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 10 (CLDN10), transcript variant X1, mRNA. (1277 bp)
OSP-L; OSPL" /codon_start=1 /product="claudin-10 isoform X1" /protein_id="XP_016876332.1" /db_xref="GeneID:9071" /db_xref="HGNC:HGNC:2033" /db_xref="MIM:617579" /translation="MSRAQIWALVSGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVAGEFIPCSLLSISENLANDRPCKLPSLCMRKINKLWLLFMLEKGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV" misc_feature 271..903 /gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: CPETRL3; HELIX; OSP-L; OSPL
XM_017020843.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X6, mRNA. (1514 bp)
variation 677 /gene="CLDND2" /replace="c" /replace="g" /db_xref="dbSNP:1392241759" CDS 679..1008 /gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2 isoform X5" /protein_id="XP_011524730.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGAPTRPS" misc_feature 706..>885 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation 681..685 /gene="CLDND2" /replace="gggg" /replace="" /db_xref="dbSNP...
XM_011526428.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 14 (CLDN14), transcript variant 5, mRNA. (1784 bp)
LOCUS NM_001146079 1784 bp mRNA linear PRI 24-OCT-2019 DEFINITION Homo sapiens claudin 14 (CLDN14), transcript variant 5, mRNA. ACCESSION NM_001146079 VERSION NM_001146079.2 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata;...from UniProtKB/Swiss-Prot (O95500.1); transmembrane region" misc_feature 776..1252 /gene="CLDN14" /gene_synonym="DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_feature 953..1015 /gene="CLDN14" /gene_synonym="DFNB29" /experiment="experimental...
Synonym: DFNB29
NM_001146079.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 19 (CLDN19), transcript variant 3, mRNA. (3517 bp)
is encoded by transcript variant 3" /codon_start=1 /product="claudin-19 isoform c" /protein_id="NP_001172046.1" /db_xref="CCDS:CCDS53306.1" /db_xref="GeneID:149461" /db_xref="HGNC:HGNC:2040" /db_xref="MIM:610036" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGMNLAQPCSWAGPQLAWPCWAAPSSAAHARSQRDPTAAHSPIGLDPLLLPESTSELRLPWPAPHPVAPLPSIQPASQHPGQGHWGIGWA" misc_feature 201..>608 /gene="CLDN19" /gene_synonym="HOMG5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
Synonym: HOMG5
NM_001185117.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 19 (CLDN19), transcript variant 2, mRNA. (3584 bp)
b is encoded by transcript variant 2" /codon_start=1 /product="claudin-19 isoform b" /protein_id="NP_001116867.1" /db_xref="CCDS:CCDS44125.1" /db_xref="GeneID:149461" /db_xref="HGNC:HGNC:2040" /db_xref="MIM:610036" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREYV" misc_feature 183..719 /gene="CLDN19" /gene_synonym="HOMG5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" misc_...
Synonym: HOMG5
NM_001123395.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/hs/claudin
lang : en | div : | spe : hs | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.079 | 0.079 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Homo sapiens (human)?to=0&format=json
0.401 | 0.322 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Homo sapiens (human)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.407 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]