GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-08-18 22:50:36, GGRNA : RefSeq release 89 (Jul, 2018)



Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Zea mays Zmhox1a homeobox protein (hox1a), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 02-JUN-2018 DEFINITION Zea mays Zmhox1a homeobox protein (hox1a), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript exon...
Synonym: GRMZM2G136369; homeobox1; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 27-MAY-2018 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (583 bp)
LOCUS NR_131758 583 bp RNA linear ROD 26-MAY-2018 DEFINITION Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_131758 VERSION NR_131758.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from AK002860.1. ##Evidence-...
Synonym: 0610040B09Rik; AV302770; Hoxb5/6as
NR_131758.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (927 bp)
LOCUS NM_001007985 927 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..379 /gene="MSX2" /inference="alignment:Splign:2.1.0" exon 380..804 /gene="MSX2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Gallus gallus homeobox B5 (HOXB5), mRNA. (1453 bp)
synonym="Ghox-2.1; Hoxb-5" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..795 /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Ghox-2.1; Hoxb-5
NM_001025355.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus msh homeobox 2 (MSX2), mRNA. (1107 bp)
LOCUS NM_204559 1107 bp mRNA linear VRT 23-JUN-2018 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 510..671 /gene="MSX2" /gene_synonym="HOX-8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(510..512,519..521,639..641,648..653,660..662) /gene="MSX2" /gene_synonym="...
Synonym: HOX-8; Msx-2
NM_204559.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. (894 bp)
" /db_xref="CDD:238039" misc_feature 511..672 /gene="TLX1" /gene_synonym="TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="TLX1" /gene_synonym="TLX-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 894) AUTHORS Logan C, Wingate RJ, McKay IJ and Lumsden A. TITLE Tlx-1 and Tlx-3 homeobox gene expression in cranial sensory ganglia and hindbrain of the chick embryo: markers of patterned connectivity...
Synonym: TLX-1
NM_205015.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 27-MAY-2018 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 289..436 /gene="HOXD8" /inference="alignment:Splign:2.1.0" exon 437..1250 /gene="HOXD8" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1263) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed chicken monoblastic leukaemia cells JOURNAL Leukemia...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D12 (HOXD12), mRNA. (1419 bp)
LOCUS NM_205249 1419 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 676..837 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(676..678,685..687,805..807,814..819,826..828) /gene="HOXD12" /note="specific DNA base...
NM_205249.1 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus homeobox B3 and homeobox B2, opposite strand (Hoxb3os), long non-coding RNA. (685 bp)
LOCUS NR_155303 685 bp RNA linear ROD 15-APR-2018 DEFINITION Mus musculus homeobox B3 and homeobox B2, opposite strand (Hoxb3os), long non-coding RNA. ACCESSION NR_155303 VERSION NR_155303.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL606824.13. Sequence Note:...
Synonym: Gm11530; Hoxb3s
NR_155303.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. (1891 bp)
LOCUS NM_001005427 1891 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_001005427 XM_418692 VERSION NM_001005427.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...MEOX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 605..763 /gene="MEOX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1891) AUTHORS Reijntjes,S., Stricker,S. and Mankoo,B.S....
NM_001005427.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1312 bp)
LOCUS NM_205488 1312 bp mRNA linear VRT 26-JUN-2018 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 569..730 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(569..571,578..580,698..700,707..712,719..721) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.2 - Gallus gallus (chicken) - NCBI - UCSC
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA. (1111 bp)
uct="homeobox protein Nkx-2.6" /protein_id="NP_990468.1" /db_xref="CGNC:49622" /db_xref="GeneID:396037" /translation="MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP" misc_feature order(224..238,242..244,293..295,311..313,350..352, 356..361,368..373,377..385,389..394) /gene="NKX2-6" /gene_synonym="NKX2.8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 230..391 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="Homeobox...
Synonym: NKX2.8
NM_205137.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus notochord homeobox (NOTO), mRNA. (1736 bp)
gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 304..462 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1736) AUTHORS Knezevic V, Ranson M and Mackem S. TITLE The organizer-associated chick homeobox gene, Gnot1, is expressed before gastrulation and regulated synergistically by activin and retinoic acid JOURNAL Dev. Biol. 171 (2), 458-470 (1995) PUBMED 7556928 REFERENCE 2 (bases 1 to 1736) AUTHORS...
Synonym: CNOT; GNOT1
NM_205354.1 - Gallus gallus (chicken) - NCBI - UCSC
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Gallus gallus motor neuron and pancreas homeobox 1 (MNX1), mRNA. (1481 bp)
LOCUS NM_204928 1481 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus motor neuron and pancreas homeobox 1 (MNX1), mRNA. ACCESSION NM_204928 VERSION NM_204928.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HLXB9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 577..738 /gene="MNX1" /gene_synonym="HB9; HLXB9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(577..579,586..588,706..708,715..720,727..729) /gene="MNX1" /gene_...
Synonym: HB9; HLXB9
NM_204928.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D13 (HOXD13), mRNA. (1964 bp)
LOCUS NM_205434 1964 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus homeobox D13 (HOXD13), mRNA. ACCESSION NM_205434 XM_429309 VERSION NM_205434.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 719..880 /gene="HOXD13" /gene_synonym="chox-4.8; chox-4G" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(719..721,728..730,848..850,857..862,869..871) /gene="HOXD13" /gene_...
Synonym: chox-4.8; chox-4G
NM_205434.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D11 (HOXD11), mRNA. (1006 bp)
LOCUS NM_204620 1006 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...GHOX4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 709..870 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(709..711,718..720,838..840,847..852,859..861) /gene="HOXD11" /gene_...
Synonym: GHOX4.6
NM_204620.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (1453 bp)
LOCUS NM_204614 1453 bp mRNA linear VRT 27-MAY-2018 DEFINITION Gallus gallus caudal type homeobox 4 (CDX4), mRNA. ACCESSION NM_204614 VERSION NM_204614.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...; other site" /db_xref="CDD:238039" misc_feature 550..708 /gene="CDX4" /gene_synonym="CDXB; CHOX-CAD2; ox-cad2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 524..669 /gene="CDX4" /gene_synonym="CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:...
Synonym: CDXB; CHOX-CAD2; ox-cad2
NM_204614.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus goosecoid homeobox (GSC), mRNA. (936 bp)
ct="homeobox protein goosecoid" /protein_id="NP_990662.1" /db_xref="CGNC:8338" /db_xref="GeneID:396273" /translation="MPASMFSIDNILAARPRCKDSVLLPPSAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSALPAVGRSRLGYNNYYYGQLHVATSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSDLDSDS" misc_feature order(451..465,469..471,520..522,538..540,577..579, 583..588,595..600,604..612,616..621) /gene="GSC" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 457..618 /gene="GSC" /note="Homeobox...
NM_205331.1 - Gallus gallus (chicken) - NCBI - UCSC
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 02-JUN-2018 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..357 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" STS 58..267 /gene="HOXC6" /standard_name="MARC_44017-44022:1098368610:3" /db_xref="UniSTS...
NM_001009335.1 - Ovis aries (sheep) - NCBI
PREDICTED: Pelodiscus sinensis homeobox protein Meis3-like (LOC102448310), partial mRNA. (655 bp)
LOCUS XM_014570120 655 bp mRNA linear VRT 04-JUN-2018 DEFINITION PREDICTED: Pelodiscus sinensis homeobox protein Meis3-like (LOC102448310), partial mRNA. ACCESSION XM_014570120 VERSION XM_014570120.1 DBLINK BioProject: PRJNA221645 KEYWORDS RefSeq; includes ab initio. SOURCE Pelodiscus sinensis...Daiwa-1" /db_xref="taxon:13735" /chromosome="Unknown" /sex="female" /country="Japan: Saga" gene 217 /gene="LOC102448310" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:293102" misc_feature 464..562 /gene="LOC102448310" /note="Homeobox KN domain; Region...
XM_014570120.1 - Pelodiscus sinensis (Chinese softshell turtle) - NCBI
Gallus gallus sensory organ homeobox protein SOHo (SOHO-1), mRNA. (1820 bp)
an homeobox protein SOHo" /protein_id="NP_990717.1" /db_xref="CGNC:49762" /db_xref="GeneID:396346" /translation="MVQLGGGRGAPPPLLAPPSAFSIDSILQPGPRCQAREQGRARCALPEDGPAEEHPTKGSTDSGSERLLAEGPRRADAEAEGAVSPLSTERFRGCRQPSLRDTGGCGRESGRCSAAGGKKKTRTIFSKSQVFQLESTFDVKRYLSSAERAGLAAALHLTETQVKIWFQNRRNKLKRQLSAEPEGPGQAEPPGEAASFSFPSLYKDSALFSRCLLPLPFPLFYPGSAIPYLCLPGPVKHFSLLDGDV" misc_feature order(417..431,435..437,486..488,504..506,543..545, 549..554,561..566,570..578,582..587) /gene="SOHO-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 423..584 /gene="SOHO-1" /note="Homeobox...
NM_205386.1 - Gallus gallus (chicken) - NCBI - UCSC
Pan troglodytes homeobox D4 (HOXD4), mRNA. (768 bp)
LOCUS NM_001081569 768 bp mRNA linear PRI 29-APR-2018 DEFINITION Pan troglodytes homeobox D4 (HOXD4), mRNA. ACCESSION NM_001081569 XM_001153123 VERSION NM_001081569.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXD4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 469..630 /gene="HOXD4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(469..471,478..480,598..600,607..612,619..621) /gene="HOXD4" /note="specific DNA base...
NM_001081569.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. (1434 bp)
LOCUS NM_204226 1434 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. ACCESSION NM_204226 VERSION NM_204226.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...misc_feature 280..531 /gene="PKNOX2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:293102" misc_feature order(862..876,880..882,940..942,958..960,997..999, 1003..1008,1015..1020,1024..1032) /gene="PKNOX2" /note="DNA binding site [nucleotide binding]" /...
NM_204226.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox A6 (HOXA6), mRNA. (1467 bp)
LOCUS NM_001030987 1467 bp mRNA linear VRT 26-JUN-2018 DEFINITION Gallus gallus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 469..627 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..436 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /inference="alignment:...
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.2 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Mus musculus reproductive homeobox 10 (Rhox10), mRNA. (760 bp)
ME, Ramaiah M, Sridhar V, de Rooij DG, Orwig KE, Zhang K and Wilkinson MF. TITLE The Homeobox Transcription Factor RHOX10 Drives Mouse Spermatogonial Stem Cell Establishment JOURNAL Cell Rep 17 (1), 149-164 (2016) PUBMED 27681428 REMARK GeneRIF: RHOX10 drives mouse spermatogonial stem cell establishment. REFERENCE 2 (bases 1 to 760) AUTHORS Song HW, Dann CT, McCarrey JR, Meistrich ML, Cornwall GA and Wilkinson MF. TITLE Dynamic expression pattern and subcellular localization of the Rhox10 homeobox transcription factor during early germ cell development JOURNAL Reproduction...
NM_001024850.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus TGFB-induced factor homeobox 2-like, X-linked 2 (Tgif2lx2), mRNA. (1032 bp)
CDS 116..811 /gene="Tgif2lx2" /codon_start=1 /product="TGFB-induced factor homeobox 2-like, X-linked 2" /protein_id="NP_001136222.1" /db_xref="CCDS:CCDS53177.1" /db_xref="GeneID:100039551" /db_xref="MGI:MGI:3800824" /translation="MEEAEGSPEETQDFMKYYSSFGIRLERTCKMKFHDSRELPRGNMLPLKSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNIEKEEKISITEPWSSPEVAWPEEKPDFSSFYMLVDVAVQKAKEMEEQKKQNPNPQGPQQQFM" misc_feature 281..397 /gene="Tgif2lx2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" STS 393..692 /...
NM_001142750.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Glycine max homeobox protein SBH1 (H1), mRNA. (1515 bp)
xref="CDD:281743" misc_feature 1056..1175 /gene="H1" /gene_synonym="Sbh1" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" exon 594..849 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" exon 850..1091 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" exon 1092..1515 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1515) AUTHORS Ma H, McMullen MD and Finer JJ. TITLE Identification of a homeobox-containing gene with enhanced expression during soybean (Glycine max L.) somatic...
Synonym: Sbh1
NM_001251129.1 - Glycine max (soybean) - NCBI
Gallus gallus caudal type homeobox 2 (CDX2), mRNA. (1460 bp)
LOCUS NM_204311 1460 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus caudal type homeobox 2 (CDX2), mRNA. ACCESSION NM_204311 VERSION NM_204311.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="CDX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 776..934 /gene="CDX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1460) AUTHORS Pernaute B, Canon S, Crespo M, Fernandez...
NM_204311.1 - Gallus gallus (chicken) - NCBI - UCSC
Bos taurus paired related homeobox 1 (PRRX1), mRNA. (1001 bp)
CDS 246..983 /gene="PRRX1" /note="paired mesoderm homeobox 1" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001075208.1" /db_xref="BGD:BT11112" /db_xref="GeneID:540901" /db_xref="VGNC:VGNC:33412" /translation="MTSSYGHVLERQPALGGRLDSPSNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNNPAQGINMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 540..695 /gene="PRRX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475"...
NM_001081739.1 - Bos taurus (cattle) - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. (1845 bp)
LOCUS NM_205252 1845 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. ACCESSION NM_205252 VERSION NM_205252.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..686 /gene="HHEX" /gene_synonym="PROBOX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 469..647 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" exon...
Synonym: PROBOX
NM_205252.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. (2141 bp)
CDD:238039" misc_feature 1148..1309 /gene="Hlx" /gene_synonym="Hlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 906..1085 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" exon 1086..1270 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" exon 1271..2116 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" ORIGIN // REFERENCE 1 (bases 1 to 2141) AUTHORS Bates MD, Dunagan DT, Welch LC, Kaul A and Harvey RP. TITLE The Hlx homeobox transcription factor is required early in enteric nervous system development...
Synonym: Hlx1
NM_001077674.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Bos taurus BARX homeobox 2 (BARX2), mRNA. (1836 bp)
LOCUS NM_001101266 1836 bp mRNA linear MAM 14-MAY-2018 DEFINITION Bos taurus BARX homeobox 2 (BARX2), mRNA. ACCESSION NM_001101266 XM_869733 VERSION NM_001101266.1 KEYWORDS RefSeq. SOURCE Bos taurus (cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="BARX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 677..838 /gene="BARX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(677..679,686..688,806..808,815..820,827..829) /gene="BARX2" /note="specific DNA base...
NM_001101266.1 - Bos taurus (cattle) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.413 | 0.413 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.795 | 0.382 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.801 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]