GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-12-08 15:37:03, GGRNA : RefSeq release 214 (Sep, 2022)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1770 bp)
LOCUS NM_006562 1770 bp mRNA linear PRI 28-AUG-2022 DEFINITION Homo sapiens ladybird homeobox 1 (LBX1), mRNA. ACCESSION NM_006562 VERSION NM_006562.5 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL135794.19. On Sep 30, 2020 this sequence version replaced NM_006562.4. Summary: This gene and...
Synonym: CCHS3; homeobox; HPX-6; HPX6; LBX1H
NM_006562.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 22-MAY-2022 DEFINITION Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript...
Synonym: GRMZM2G136369; homeobox1; hox1a; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
2; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="propagated from UniProtKB/Swiss-Prot (Q804R0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..858 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="propagated from UniProtKB/Swiss-Prot (Q01703.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (583 bp)
LOCUS NR_131758 583 bp RNA linear ROD 22-AUG-2022 DEFINITION Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_131758 VERSION NR_131758.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from AK002860.1. ##Evidence-...
Synonym: 0610040B09Rik; Hoxb5/6as
NR_131758.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Homo sapiens tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 3, mRNA. (523 bp)
tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 3, mRNA. ACCESSION NM_001397349 VERSION NM_001397349.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC024582.7. On Nov 10, 2021 this sequence version replaced NM_001397349.1. Summary: Homeobox genes encode DNA-binding proteins...
Synonym: TPRX2P; TPRX2P1; TPRXP1
NM_001397349.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.3 - Gallus gallus (chicken) - NCBI - UCSC
Homo sapiens tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 2, mRNA. (1032 bp)
tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 2, mRNA. ACCESSION NM_001397348 VERSION NM_001397348.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC024582.7. On Nov 10, 2021 this sequence version replaced NM_001397348.1. Summary: Homeobox genes encode DNA-binding proteins...
Synonym: TPRX2P; TPRX2P1; TPRXP1
NM_001397348.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox B5 (HOXB5), mRNA. (1453 bp)
synonym="Ghox-2.1; Hoxb-5" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..798 /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Ghox-2.1; Hoxb-5
NM_001025355.1 - Gallus gallus (chicken) - NCBI - UCSC
Homo sapiens tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 1, mRNA. (1127 bp)
tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 1, mRNA. ACCESSION NM_001397347 VERSION NM_001397347.2 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC024582.7. On Nov 10, 2021 this sequence version replaced NM_001397347.1. Summary: Homeobox genes encode DNA-...
Synonym: TPRX2P; TPRX2P1; TPRXP1
NM_001397347.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
misc_feature 341..523 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN // REFERENCE 1 (bases 1 to 1963) AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D., Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V., Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L., Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L., Tallon,L.J., Gill,J.E., Adams,M.D...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (1487 bp)
LOCUS NM_001007985 1487 bp mRNA linear VRT 11-JUN-2022 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 743..907 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(743..745,752..754,872..874,881..886,893..895) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.2 - Gallus gallus (chicken) - NCBI - UCSC
Capsicum annuum homeobox-leucine zipper protein HAT22 (LOC107860150), mRNA. (1064 bp)
HB1" /note="homeodomain leucine-zipper 1" /codon_start=1 /product="homeobox-leucine zipper protein HAT22" /protein_id="NP_001311712.1" /db_xref="GeneID:107860150" /translation="MGFDDICNTGLVLGLGFSSTTDQKSTKITPLASKGPASLTFEPSLTLSLISGDRTYEQQATKKVNVTKPSNDHQSADLYRQDSAASSYSNASVKRERDVGSEETTTEVERVSSRVISDEDDDGSNARKKLRLTKAQSALLEESFKLHSTLNPKQKQDLAMELSLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTEENRRLHKELQELKALKIAQPLYMQLPAATLTMCPSCERIGGGVGENPSKNPFTIAQKPHFYSPFNNPSAAC" misc_feature 391..543 /gene="LOC107860150" /gene_synonym="HB1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_...
Synonym: HB1
NM_001324783.1 - Capsicum annuum - NCBI
Gallus gallus homeobox D12 (HOXD12), mRNA. (1332 bp)
LOCUS NM_205249 1332 bp mRNA linear VRT 16-APR-2022 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 608..769 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(608..610,617..619,737..739,746..751,758..760) /gene="HOXD12" /note="specific DNA base...
NM_205249.2 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Hydra vulgaris homeobox protein OTX2-like (LOC100211908), mRNA. (1355 bp)
LOCUS NM_001309768 1355 bp mRNA linear INV 17-APR-2022 DEFINITION Hydra vulgaris homeobox protein OTX2-like (LOC100211908), mRNA. ACCESSION NM_001309768 VERSION NM_001309768.1 KEYWORDS RefSeq. SOURCE Hydra vulgaris (swiftwater hydra) ORGANISM Hydra vulgaris Eukaryota; Metazoa; Cnidaria; Hydrozoa;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 112..270 /gene="LOC100211908" /gene_synonym="CnOtx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: CnOtx
NM_001309768.1 - Hydra vulgaris (swiftwater hydra) - NCBI
Capsicum annuum homeobox-leucine zipper protein ATHB-12-like (LOC107863056), mRNA. (969 bp)
ZIP" /note="homeobox-leucine zipper protein ATHB-12-like" /db_xref="GeneID:107863056" CDS 50..712 /gene="LOC107863056" /gene_synonym="HD-ZIP" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-12-like" /protein_id="NP_001311778.1" /db_xref="GeneID:107863056" /translation="MESEHEKSETPNFKRPLKKKCENAKRFTDEQVKLLESMFKLGTKIEPREKLQLARDLGLQPRQVAIWFQNKRARWKSKQLEHEYRILQSKFDHLNTQFESLKIEKERLLIELETLNDQLGNKLARGSKSQDSRDSELHTSPENGFTDLLELKHCAGCSNSRFGHKSVNEEDDETTEETDKYFTPKEEAEFWNLDELGDNNSLEHWCVGLGSISNSKLWDF" misc_feature 125..277 /gene="LOC107863056" /gene_synonym="HD-ZIP" /note="Homeobox domain;...
Synonym: HD-ZIP
NM_001324849.1 - Capsicum annuum - NCBI
Hydra vulgaris homeobox protein Hox-D10-like (LOC100197809), mRNA. (1781 bp)
LOCUS NM_001309758 1781 bp mRNA linear INV 17-APR-2022 DEFINITION Hydra vulgaris homeobox protein Hox-D10-like (LOC100197809), mRNA. ACCESSION NM_001309758 VERSION NM_001309758.1 KEYWORDS RefSeq. SOURCE Hydra vulgaris (swiftwater hydra) ORGANISM Hydra vulgaris Eukaryota; Metazoa; Cnidaria; Hydrozoa...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 511..672 /gene="LOC100197809" /gene_synonym="cnox-1; Cnox-3; hox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="LOC100197809" /...
Synonym: cnox-1; Cnox-3; hox1
NM_001309758.1 - Hydra vulgaris (swiftwater hydra) - NCBI
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 25-FEB-2022 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000220.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus msh homeobox 2 (MSX2), mRNA. (2289 bp)
LOCUS NM_204559 2289 bp mRNA linear VRT 22-MAY-2022 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 494..658 /gene="MSX2" /gene_synonym="HOX-8; HOX8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(494..496,503..505,623..625,632..637,644..646) /gene="MSX2" /gene_...
Synonym: HOX-8; HOX8; Msx-2
NM_204559.2 - Gallus gallus (chicken) - NCBI - UCSC
Homo sapiens tetrapeptide repeat homeobox 1 (TPRX1), transcript variant 2, mRNA. (2070 bp)
collaboration with Anne Booth and Peter Holland. The reference sequence was derived from AC008745.7. On Jul 13, 2021 this sequence version replaced NM_198479.2. Summary: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the TPRX homeobox gene family. [provided by RefSeq, Jul 2008]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the...
Synonym: TPRX
NM_198479.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox C6 (HOXC6), mRNA. (714 bp)
LOCUS NM_001407494 714 bp mRNA linear VRT 02-JUN-2022 DEFINITION Gallus gallus homeobox C6 (HOXC6), mRNA. ACCESSION NM_001407494 VERSION NM_001407494.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JN129278.1....
Synonym: HOXC-6
NM_001407494.1 - Gallus gallus (chicken) - NCBI - UCSC
Hydra vulgaris homeobox protein Hox-C6a-like (LOC100215022), mRNA. (991 bp)
gene="LOC100215022" /gene_synonym="Cnox-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 991) AUTHORS Gauchat D, Mazet F, Berney C, Schummer M, Kreger S, Pawlowski J and Galliot B. TITLE Evolution of Antp-class genes and differential expression of Hydra Hox/paraHox genes in anterior patterning JOURNAL Proc Natl Acad Sci U S A 97 (9), 4493-4498 (2000) PUBMED 10781050 REFERENCE 2 (bases 1 to 991) AUTHORS Shenk MA, Bode HR and Steele RE. TITLE Expression of Cnox-2, a HOM/HOX homeobox gene in hydra, is correlated with axial pattern...
Synonym: Cnox-2
NM_001287796.1 - Hydra vulgaris (swiftwater hydra) - NCBI
Brassica napus homeobox-leucine zipper protein ATHB-6-like (LOC106363703), mRNA. (1572 bp)
LOCUS NM_001315814 1572 bp mRNA linear PLN 04-JUL-2022 DEFINITION Brassica napus homeobox-leucine zipper protein ATHB-6-like (LOC106363703), mRNA. ACCESSION NM_001315814 VERSION NM_001315814.1 KEYWORDS RefSeq. SOURCE Brassica napus (rape) ORGANISM Brassica napus Eukaryota; Viridiplantae;...gene="LOC106363703" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 390..551 /gene="LOC106363703" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(390..392,399..401,519..521,528..533,540..542) /gene="LOC106363703" /note="...
NM_001315814.1 - Brassica napus (rape) - NCBI
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
Synonym: ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Orcinus orca NK6 homeobox 3 (LOC101284637), mRNA. (774 bp)
db_xref="GeneID:101284637" CDS 1..774 /gene="LOC101284637" /codon_start=1 /product="homeobox protein Nkx-6.3" /protein_id="XP_004285107.1" /db_xref="GeneID:101284637" /translation="MESNLQGPFLLNNAPLAQFSEVKAPVCQYSVQNSFYKLSPQGLGPQLPAGTPHGITDILSRPVAAPNSSLLSGYPHVAGFGGLGSQGVYYGPQVGNFSKAGNEYPTRTRNCWADTGQDWRGGRPCGNTPDPLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEPSSSTPRASGGDRAASENDDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHS" misc_feature 424..588 /gene="LOC101284637" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN //...
XM_004285059.1 - Orcinus orca (killer whale) - NCBI
PREDICTED: Orcinus orca distal-less homeobox 5 (LOC101284473), mRNA. (1439 bp)
CDS 207..1076 /gene="LOC101284473" /codon_start=1 /product="homeobox protein DLX-5" /protein_id="XP_004265612.1" /db_xref="GeneID:101284473" /translation="MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGAAGSYPAKAYADYSYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY" misc_feature 300..560 /gene="LOC101284473" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="CDD:403572" misc_...
XM_004265564.3 - Orcinus orca (killer whale) - NCBI
Brassica napus homeobox-leucine zipper protein ATHB-12-like (LOC106345588), mRNA. (693 bp)
Data-END## FEATURES Location/Qualifiers source 1..693 /organism="Brassica napus" /mol_type="mRNA" /db_xref="taxon:3708" /chromosome="A9" /map="A9" gene 1..693 /gene="LOC106345588" /gene_synonym="ATHB-12" /note="homeobox-leucine zipper protein ATHB-12-like" /db_xref="GeneID:106345588" CDS 1..693 /gene="LOC106345588" /gene_synonym="ATHB-12" /codon_start=1 /product="Homeobox-leucine zipper protein ATHB-12-like" /protein_id="NP_001302890.1" /db_xref="GeneID:106345588" /translation="...
Synonym: ATHB-12
NM_001315961.1 - Brassica napus (rape) - NCBI
PREDICTED: Orcinus orca visual system homeobox 1 (LOC101286880), transcript variant X2, mRNA. (642 bp)
to: 2 Proteins" /db_xref="GeneID:101286880" CDS 1..642 /gene="LOC101286880" /codon_start=1 /product="visual system homeobox 1 isoform X2" /protein_id="XP_012388684.1" /db_xref="GeneID:101286880" /translation="MTGRDALSDGRARSRALVPGGPPTGSRPRGFAITDLLGLEAELPAPAGPGPGSGCEGPAAAPCAGPRLWGSCLARGALPLGLGLLCGFGAQPPAAARAPCLLLADVPFLPPEGPEPSAPQVPGRPPTPAARQKRSESVSTSDEDSPSEDRSDLKASPAPGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQQVRN" misc_feature 499..>627 /gene="LOC101286880" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" ORIGIN //...
XM_012533230.1 - Orcinus orca (killer whale) - NCBI
Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. (714 bp)
LOCUS NM_001037581 714 bp mRNA linear ROD 30-AUG-2022 DEFINITION Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. ACCESSION NM_001037581 VERSION NM_001037581.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 348..497 /gene="Rhox10" /gene_synonym="Rhoxf10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 419..464 /gene="Rhox10" /gene_synonym="Rhoxf10" /inference="alignment:Splign:2.1.0"...
Synonym: Rhoxf10
NM_001037581.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Orcinus orca Meis homeobox 1 (LOC101270805), transcript variant X4, mRNA. (2290 bp)
"homeobox protein Meis1 isoform X4" /protein_id="XP_033256285.1" /db_xref="GeneID:101270805" /translation="MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGKSPIVTVFKSRRRKASSSHSPGGPIPVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM" misc_feature 1182..1436 /gene="LOC101270805" /note="N-terminal of Homeobox...
XM_033400394.2 - Orcinus orca (killer whale) - NCBI
PREDICTED: Orcinus orca BARX homeobox 1 (LOC101283461), mRNA. (838 bp)
Proteins" /db_xref="GeneID:101283461" CDS 1..765 /gene="LOC101283461" /codon_start=1 /product="homeobox protein BarH-like 1" /protein_id="XP_004284151.1" /db_xref="GeneID:101283461" /translation="MQRPGEPGAVRFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLGSALLAAGPGLPGAAGAPHLPLELQLRGKLEAPGAGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKEAEKPAEAPGEAGDRSHED" misc_feature 433..597 /gene="LOC101283461" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN //...
XM_004284103.2 - Orcinus orca (killer whale) - NCBI
Hydra vulgaris retinal homeobox protein Rx-B-like (LOC100212761), mRNA. (855 bp)
LOCUS NM_001315510 855 bp mRNA linear INV 17-APR-2022 DEFINITION Hydra vulgaris retinal homeobox protein Rx-B-like (LOC100212761), mRNA. ACCESSION NM_001315510 VERSION NM_001315510.1 KEYWORDS RefSeq. SOURCE Hydra vulgaris (swiftwater hydra) ORGANISM Hydra vulgaris Eukaryota; Metazoa; Cnidaria;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 392..550 /gene="LOC100212761" /gene_synonym="manacle" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 351..517 /gene="LOC100212761" /gene_synonym="manacle" /inference="alignment:Splign...
Synonym: manacle
NM_001315510.1 - Hydra vulgaris (swiftwater hydra) - NCBI
PREDICTED: Orcinus orca goosecoid homeobox 2 (LOC101287155), transcript variant X5, mRNA. (2286 bp)
coid homeobox 2; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:101287155" CDS 1446..2144 /gene="LOC101287155" /codon_start=1 /product="homeobox protein goosecoid-2 isoform X5" /protein_id="XP_033295463.1" /db_xref="GeneID:101287155" /translation="MRPGGPPASPLMAPPSPPLMACLAISSPAICFQSWTQGARGSQAAPSTPPLGISVATSSASPGARLPWPLRLGPAAPLPLAVPTGGSGAPPGAGGPGPQRRTRRHRTIFSEEQLQALEALFVQNQYPDVGTRERLAGRIRLREERVEVGACSLGRVGLAWRAEAHRPRESRGAGSGSRTAGPSGDTRSAHRHPRGSCREPRSPRRRAADGCRVTPGLGGTLWGRLRERTDLP" misc_feature 1758..>1889 /gene="LOC101287155" /note="Homeobox...
XM_033439572.2 - Orcinus orca (killer whale) - NCBI
PREDICTED: Orcinus orca GS homeobox 1 (LOC101279010), mRNA. (836 bp)
Proteins" /db_xref="GeneID:101279010" CDS 41..832 /gene="LOC101279010" /codon_start=1 /product="GS homeobox 1" /protein_id="XP_004281816.2" /db_xref="GeneID:101279010" /translation="MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPSFGSQYCHAPLGRQHSAVSPGVAHGPLYQTSYPLPDPRQFHCISLDNSSNQLPSSKRMRTAFTSAQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGSAGAGGGAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP" misc_feature 491..652 /gene="LOC101279010" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN //...
XM_004281768.4 - Orcinus orca (killer whale) - NCBI
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_053630) mRNA, complete cds. (747 bp)
locus_tag="EIN_053630" /note="encoded by transcript EIN_053630A" /codon_start=1 /product="homeobox protein knotted-1, putative" /protein_id="XP_004259889.1" /db_xref="GeneID:14892326" /translation="MEPTQEVQKVLTECVNKTIDFDQYLKCFEQSLVRPSGDISDQSLMEKVQHVADLVTGEKLLRLNELVQIFNSQAEVLYLYYTSYYTQLVSLLDSQSQKRIVTQDERSYKISCLRALFGNIYSHLKLMFGSNVSSLAPRERKIPTFLSPQISVHSITSQSQPLSKITCKNSLVLSSTKPTKPIFKIDKIKTQSPKTQKIKPLLDWFVLHSNHPYPTEEQKERLGSECGMSPKQVGTWFSNKRNRNKNQN" misc_feature 610..711 /locus_tag="EIN_053630" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1...
XM_004259841.1 - Entamoeba invadens IP1 - NCBI
PREDICTED: Astyanax mexicanus NK2 homeobox 2b (nkx2.2b), mRNA. (3292 bp)
K2 homeobox 2b; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:107197780" CDS 270..944 /gene="nkx2.2b" /codon_start=1 /product="NK2 homeobox 2b" /protein_id="XP_015462880.2" /db_xref="GeneID:107197780" /translation="MSNTKMGFSVRDILNLKDVEEEFGAEDTEDEDPPATSQRLADTGTSTRNSVWMGTSEYQSPFCPGEADPEDRLEAEEGSQSSEARATTEGPERKRRMRKRRVLFSRAQTCELERRFRQQRYLSGPEREHLAHSLRLTPTQVKIWFQNHRYKMKRAERGRELAVPILLRDHRTCSVKPHDFVAPLLHTGLQFPLGAQHFHPVNFNSAVCSNLAHVQPWSW" misc_feature 594..743 /gene="nkx2.2b" /note="Homeobox...
XM_015607394.3 - Astyanax mexicanus (Mexican tetra) - NCBI
PREDICTED: Orcinus orca homeobox C12 (LOC101280406), mRNA. (7497 bp)
GeneID:101280406" CDS 2091..2930 /gene="LOC101280406" /codon_start=1 /product="homeobox protein Hox-C12" /protein_id="XP_004274283.1" /db_xref="GeneID:101280406" /translation="MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDSKGYYREPCAELKREERGRDPGPGVGPGAALLQLEPSGPPALGFKYDYAAGGEGGAGPPHDPPSCQSLESDSSSSLLNEGNKGAGAGDPGSLVSPLNPGGGLAASGAPWYPIHSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALSFF" misc_feature 2730..2894 /gene="LOC101280406" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN //...
XM_004274235.3 - Orcinus orca (killer whale) - NCBI
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (2614 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 586..731 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" exon 732..2614 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2614) AUTHORS Joshi P, Darr AJ and Skromne I. TITLE CDX4 regulates the progression of neural maturation in the spinal cord JOURNAL Dev Biol 449 (2), 132-142 (2019) PUBMED 30825428 REMARK GeneRIF: Results show that in the spinal cord, caudal type homeobox 4 (CDX4) is...
Synonym: cCdx-B; CDXB; CHOX-CAD2; ox-cad2
NM_204614.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. (2493 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(959..961,968..970,1088..1090,1097..1102,1109..1111) /gene="TLX1" /gene_synonym="HOX11; TLX-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 918..1119 /gene="TLX1" /gene_synonym="HOX11; TLX-1" /inference="alignment:Splign:2.1.0" exon 1120..2493 /gene="TLX1" /gene_synonym="HOX11; TLX-1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2493) AUTHORS Logan C, Wingate RJ, McKay IJ and Lumsden A. TITLE Tlx-1 and Tlx-3 homeobox gene...
Synonym: HOX11; TLX-1
NM_205015.2 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Orcinus orca Meis homeobox 2 (LOC101285099), transcript variant X7, mRNA. (2434 bp)
product="homeobox protein Meis2 isoform X7" /protein_id="XP_033291730.1" /db_xref="GeneID:101285099" /translation="MALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGEYVSQGGPMGMSMGQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPSHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ" misc_feature 180..434 /gene="LOC101285099" /note="N-terminal of Homeobox Meis and PKNOX1;...
XM_033435839.2 - Orcinus orca (killer whale) - NCBI
PREDICTED: Orcinus orca homeobox B7 (LOC101288445), mRNA. (2396 bp)
mRNAs, 29 Proteins" /db_xref="GeneID:101288445" CDS 1150..1803 /gene="LOC101288445" /codon_start=1 /product="homeobox protein Hox-B7" /protein_id="XP_004282713.1" /db_xref="GeneID:101288445" /translation="MSSLYYANALFSKYPAASSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTAGPGATRQDKAEAEEDEEE" misc_feature 1570..1731 /gene="LOC101288445" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" polyA_site 2396 /gene="LOC101288445" /experiment="...
XM_004282665.3 - Orcinus orca (killer whale) - NCBI
PREDICTED: Orcinus orca HESX homeobox 1 (LOC101282554), transcript variant X3, mRNA. (2369 bp)
HESX homeobox 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA" /db_xref="GeneID:101282554" CDS 1187..1696 /gene="LOC101282554" /codon_start=1 /product="homeobox expressed in ES cells 1 isoform X2" /protein_id="XP_033280533.1" /db_xref="GeneID:101282554" /translation="MYPASYRSQQYNSGLRHFSSISTVACNLAIKKEDFQGKEFNLCLHVPSLPNGISLPCTVDHSVPEESVLKYEGYFSPSERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLARKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTDLLE" misc_feature 1469..1633 /gene="LOC101282554" /note="Homeobox domain;...
XM_033424642.2 - Orcinus orca (killer whale) - NCBI
Gallus gallus notochord homeobox (NOTO), transcript variant 3, non-coding RNA. (1742 bp)
LOCUS NR_171275 1742 bp RNA linear VRT 18-APR-2022 DEFINITION Gallus gallus notochord homeobox (NOTO), transcript variant 3, non-coding RNA. ACCESSION NR_171275 VERSION NR_171275.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was...
Synonym: CNOT; GNOT1
NR_171275.2 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Orcinus orca NK2 homeobox 4 (LOC101283328), mRNA. (1080 bp)
CDS 13..1080 /gene="LOC101283328" /codon_start=1 /product="homeobox protein Nkx-2.4" /protein_id="XP_004270471.1" /db_xref="GeneID:101283328" /translation="MSLSPKHTTPFSVSDILSPIEETYKKFGGAMDGTPPGLGAPLGYRAPPTGPSSQAAAVAGMQPPHAMAGHNTYHMPPGVPQFPHGAMGGYCNGGLGNMGELPAYTDGMRSGTGWYGANPDPRFSSISRFMGQSAGVNVAGMGSLPGIADAAKSLAPLHTPPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEVGLGPPPPSPRRVAVPVLVKDGKPCQNGAATPTPGQAGPQPPAPTPAPELEELSPSPPALHGPGGGLAALDAAAGDYGGGALGANLLYGRTW" misc_feature 610..759 /gene="LOC101283328" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475"...
XM_004270423.3 - Orcinus orca (killer whale) - NCBI
Rattus norvegicus cut-like homeobox 1, pseudogene 1 (Cux1-ps1), non-coding RNA. (2849 bp)
LOCUS NR_176814 2849 bp RNA linear ROD 12-JUL-2022 DEFINITION Rattus norvegicus cut-like homeobox 1, pseudogene 1 (Cux1-ps1), non-coding RNA. ACCESSION NR_176814 XM_039108675 VERSION NR_176814.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000142.1. On Jul...
NR_176814.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Orcinus orca homeobox B4 (LOC101289602), mRNA. (5122 bp)
Proteins" /db_xref="GeneID:101289602" CDS 3171..3926 /gene="LOC101289602" /codon_start=1 /product="homeobox protein Hox-B4" /protein_id="XP_004282718.1" /db_xref="GeneID:101289602" /translation="MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRSACTVQRYAACRDPGGLSPRAPAPPPSGALLPEPGQRCEAVSSSCAQNPLHPSPSHSACKEPIVYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGTAGAAGGPPGRPNGGPPAL" misc_feature 3663..3827 /gene="LOC101289602" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" polyA_site 5122 /gene="LOC101289602" /experiment="...
XM_004282670.3 - Orcinus orca (killer whale) - NCBI
PREDICTED: Orcinus orca distal-less homeobox 3 (LOC101280791), transcript variant X1, mRNA. (2598 bp)
GeneID:101280791" CDS 240..1103 /gene="LOC101280791" /codon_start=1 /product="homeobox protein DLX-3" /protein_id="XP_004282679.1" /db_xref="GeneID:101280791" /translation="MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGTSYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEAPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQPPPQPAALHHASPGPPPNPGAVY" misc_feature 318..560 /gene="LOC101280791" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="CDD...
XM_004282631.3 - Orcinus orca (killer whale) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/en/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.230 | 0.230 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.409 | 0.180 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.415 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]