GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-02-19 16:54:21, GGRNA : RefSeq release 86 (Jan, 2018)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Zea mays Zmhox1a homeobox protein (hox1a), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 02-OCT-2017 DEFINITION Zea mays Zmhox1a homeobox protein (hox1a), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript exon...
Synonym: GRMZM2G136369; homeobox1; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X2, mRNA. (5376 bp)
LOCUS XM_008675213 5376 bp mRNA linear PLN 18-DEC-2017 DEFINITION PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X2, mRNA. ACCESSION XM_008675213 VERSION XM_008675213.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
XM_008675213.3 - Zea mays - NCBI
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X1, mRNA. (5456 bp)
LOCUS XM_008675212 5456 bp mRNA linear PLN 18-DEC-2017 DEFINITION PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X1, mRNA. ACCESSION XM_008675212 VERSION XM_008675212.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
XM_008675212.3 - Zea mays - NCBI
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
MSX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic analysis in dogs of different breeds JOURNAL Anim. Genet...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Gallus gallus paired related homeobox 1 (PRRX1), transcript variant 2, mRNA. (895 bp)
oduct; homeobox protein MHOX; paired-related homeobox protein 1; transcription factor Prx1b" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001007822.1" /db_xref="CGNC:48968" /db_xref="GeneID:373941" /translation="MASSYAHAMERQALLPARLDGPAGLDNLQAKKNFSVSHLLDLEEAGDMVAAQGDEGGGEPGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLASKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSTTCTNASPAQGMNMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 325..480 /gene="PRRX1" /gene_synonym="gMHox; homeobox; PMX1; Prx-1; Prx1" /note="Homeobox domain...
Synonym: gMHox; homeobox; PMX1; Prx-1; Prx1
NM_001007821.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X3, mRNA. (5441 bp)
LOCUS XM_008675215 5441 bp mRNA linear PLN 18-DEC-2017 DEFINITION PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X3, mRNA. ACCESSION XM_008675215 VERSION XM_008675215.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
XM_008675215.3 - Zea mays - NCBI
Gallus gallus paired related homeobox 1 (PRRX1), transcript variant 1, mRNA. (1879 bp)
oduct; homeobox protein MHOX; paired-related homeobox protein 1; transcription factor Prx1b" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001264653.1" /db_xref="CGNC:48968" /db_xref="GeneID:373941" /translation="MASSYAHAMERQALLPARLDGPAGLDNLQAKKNFSVSHLLDLEEAGDMVAAQGDEGGGEPGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLASKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSTTCTNASPAQGMNMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 530..685 /gene="PRRX1" /gene_synonym="gMHox; homeobox; PMX1; Prx-1; Prx1" /note="Homeobox domain...
Synonym: gMHox; homeobox; PMX1; Prx-1; Prx1
NM_001277724.1 - Gallus gallus (chicken) - NCBI - UCSC
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Canis lupus familiaris cone-rod homeobox (CRX), mRNA. (3299 bp)
feature 229..387 /gene="CRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 592..849 /gene="CRX" /note="Otx1 transcription factor; Region: TF_Otx; pfam03529" /db_xref="CDD:281521" STS 103..1002 /gene="CRX" /standard_name="Crx" /db_xref="UniSTS:546710" ORIGIN // REFERENCE 1 (bases 1 to 3299) AUTHORS Akhmedov NB, Baldwin VJ, Zangerl B, Kijas JW, Hunter L, Minoofar KD, Mellersh C, Ostrander EA, Acland GM, Farber DB and Aguirre GD. TITLE Cloning and characterization of the canine photoreceptor specific cone-rod homeobox (CRX) gene and evaluation as a...
NM_001003049.1 - Canis lupus familiaris (dog) - NCBI
Zea mays HOX1B protein (Hox1b), mRNA. (2974 bp)
c 1346-2098 EB403344.1 1-753 2099-2974 LPUQ01002925.1 503323-504198 c FEATURES Location/Qualifiers source 1..2974 /organism="Zea mays" /mol_type="mRNA" /cultivar="B73" /db_xref="taxon:4577" /chromosome="6" /map="6" gene 1..2974 /gene="Hox1b" /gene_synonym="GRMZM2G094935; homeobox2" /note="HOX1B protein" /db_xref="GeneID:732843" misc_feature 242..244 /gene="Hox1b" /gene_synonym="GRMZM2G094935; homeobox2" /note="upstream in-frame stop codon" CDS 254..2332 /gene="Hox1b" /gene_synonym="GRMZM2G094935; homeobox2" /note="putative homeodomain-like transcription factor superfamily protein" /codon_start...
Synonym: GRMZM2G094935; homeobox2
NM_001112448.2 - Zea mays - NCBI
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Zea mays homeobox-leucine zipper protein ATHB-4 (LOC100284930), mRNA. (1237 bp)
LOCUS NM_001157825 1237 bp mRNA linear PLN 29-DEC-2017 DEFINITION Zea mays homeobox-leucine zipper protein ATHB-4 (LOC100284930), mRNA. ACCESSION NM_001157825 VERSION NM_001157825.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 363..515 /gene="LOC100284930" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 519..>614 /gene="LOC100284930" /note="Homeobox associated leucine zipper; Region...
NM_001157825.1 - Zea mays - NCBI
Zea mays homeobox 3 (hox3), mRNA. (5334 bp)
LOCUS NM_001309211 5334 bp mRNA linear PLN 07-SEP-2017 DEFINITION Zea mays homeobox 3 (hox3), mRNA. ACCESSION NM_001309211 XM_008675214 VERSION NM_001309211.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from LPUQ01001404.1. On May 21, 2015 this sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
NM_001309211.1 - Zea mays - NCBI
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 01-OCT-2017 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Canis lupus familiaris pancreatic and duodenal homeobox 1 (PDX1), mRNA. (1496 bp)
misc_feature 540..701 /gene="PDX1" /gene_synonym="IPF1; PDX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(540..542,549..551,669..671,678..683,690..692) /gene="PDX1" /gene_synonym="IPF1; PDX-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 1496) AUTHORS Takemitsu H, Yamamoto I, Lee P, Ohta T, Mori N and Arai T. TITLE cDNA cloning and mRNA expression of canine pancreatic and duodenum homeobox 1 (Pdx-1) JOURNAL Res. Vet. Sci. 93 (2), 770-775 (2012) PUBMED 22172402...
Synonym: IPF1; PDX-1
NM_001284471.2 - Canis lupus familiaris (dog) - NCBI
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL Development 127 (23), 5033-5045 (2000) PUBMED...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus Rhox homeobox family member 7 (Rhox7), mRNA. (900 bp)
Rhox homeobox family member 7" /protein_id="NP_001020825.1" /db_xref="GeneID:298353" /db_xref="RGD:1563189" /translation="MWFSNRRAKERACEKKAMPRSIPGAKAQMILPAGEGRNGEESERSSPGQEASATKWGEVEELGERDRTGSDGENLSAVGTSGIRNDWDKEGASSSRQKNESRPQKPVPECRWGMEDVQPVPVLIPRVQRIQLVQSRVQSVPLKVPTPRIRPVAVSATTVQPEPVLVPRRHLHDRFTDPELQELERERVFQRNHYLSAEERKELARVMGVSEAKVQRWFKKRREHFRREQSQSGGAPPGNTPPLSEDGAGALVYHP" misc_feature order(520..522,646..648,655..660,667..669) /gene="Rhox7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..666 /gene="Rhox7" /note="Homeobox domain;...
NM_001025654.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Zea mays WUSCHEL-related homeobox 7-like (LOC103636156), mRNA. (1929 bp)
LOCUS NM_001301585 1929 bp mRNA linear PLN 29-DEC-2017 DEFINITION Zea mays WUSCHEL-related homeobox 7-like (LOC103636156), mRNA. ACCESSION NM_001301585 XM_008658507 VERSION NM_001301585.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta;...site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 407..583 /gene="LOC103636156" /gene_synonym="GRMZM2G133972; wox9A; wox9b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(407..409,416..418,551..553,560..565,572..574) /gene="LOC103636156" /...
Synonym: GRMZM2G133972; wox9A; wox9b
NM_001301585.1 - Zea mays - NCBI
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AABR07030395.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Zea mays HOX1B protein (Hox1b), transcript variant X1, mRNA. (2893 bp)
Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2893 /organism="Zea mays" /mol_type="mRNA" /cultivar="B73" /db_xref="taxon:4577" /chromosome="6" /tissue_type="seedling" /country="USA" gene 1..2893 /gene="Hox1b" /gene_synonym="GRMZM2G094935; homeobox2" /note="HOX1B protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 ESTs, 14 long SRA reads, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 189 samples with support for all...
Synonym: GRMZM2G094935; homeobox2
XM_020539217.2 - Zea mays - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Zea mays WUSCHEL-related homeobox 12-like (wox9C), mRNA. (1793 bp)
LOCUS NM_001301554 1793 bp mRNA linear PLN 29-DEC-2017 DEFINITION Zea mays WUSCHEL-related homeobox 12-like (wox9C), mRNA. ACCESSION NM_001301554 XM_008651787 VERSION NM_001301554.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 160..342 /gene="wox9C" /gene_synonym="GRMZM2G409881" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(160..162,169..171,304..306,313..318,325..327) /gene="wox9C" /gene_synonym...
Synonym: GRMZM2G409881
NM_001301554.1 - Zea mays - NCBI
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (927 bp)
LOCUS NM_001007985 927 bp mRNA linear VRT 01-OCT-2017 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.1 - Gallus gallus (chicken) - NCBI - UCSC
Brassica napus homeobox-leucine zipper protein ATHB-6-like (LOC106363703), mRNA. (1572 bp)
LOCUS NM_001315814 1572 bp mRNA linear PLN 09-OCT-2017 DEFINITION Brassica napus homeobox-leucine zipper protein ATHB-6-like (LOC106363703), mRNA. ACCESSION NM_001315814 VERSION NM_001315814.1 KEYWORDS RefSeq. SOURCE Brassica napus (rape) ORGANISM Brassica napus Eukaryota; Viridiplantae;...gene="LOC106363703" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 390..551 /gene="LOC106363703" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(390..392,399..401,519..521,528..533,540..542) /gene="LOC106363703" /note="...
NM_001315814.1 - Brassica napus (rape) - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_053630) mRNA, complete cds. (747 bp)
locus_tag="EIN_053630" /note="encoded by transcript EIN_053630A" /codon_start=1 /product="homeobox protein knotted-1, putative" /protein_id="XP_004259889.1" /db_xref="GeneID:14892326" /translation="MEPTQEVQKVLTECVNKTIDFDQYLKCFEQSLVRPSGDISDQSLMEKVQHVADLVTGEKLLRLNELVQIFNSQAEVLYLYYTSYYTQLVSLLDSQSQKRIVTQDERSYKISCLRALFGNIYSHLKLMFGSNVSSLAPRERKIPTFLSPQISVHSITSQSQPLSKITCKNSLVLSSTKPTKPIFKIDKIKTQSPKTQKIKPLLDWFVLHSNHPYPTEEQKERLGSECGMSPKQVGTWFSNKRNRNKNQN" misc_feature 610..711 /locus_tag="EIN_053630" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1...
XM_004259841.1 - Entamoeba invadens IP1 - NCBI
Bos taurus paired related homeobox 1 (PRRX1), mRNA. (1001 bp)
CDS 246..983 /gene="PRRX1" /note="paired mesoderm homeobox 1" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001075208.1" /db_xref="BGD:BT11112" /db_xref="GeneID:540901" /db_xref="VGNC:VGNC:33412" /translation="MTSSYGHVLERQPALGGRLDSPSNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNNPAQGINMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 540..695 /gene="PRRX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475"...
NM_001081739.1 - Bos taurus (cattle) - NCBI
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (636 bp)
organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="Rhox homeobox family member 5" /db_xref="GeneID:24631" /db_xref="RGD:3295" CDS 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.1" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Bos taurus homeobox A10 (HOXA10), mRNA. (1809 bp)
stop codon" CDS 240..524 /gene="HOXA10" /note="homeobox protein A10" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001098487.1" /db_xref="BGD:BT30321" /db_xref="GeneID:784386" /translation="MCQGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(300..314,318..320,369..371,387..389,426..428, 432..437,444..449,453..461,465..470) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 306..467 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
NM_001105017.1 - Bos taurus (cattle) - NCBI
Bos taurus ESX homeobox 1 (ESX1), mRNA. (1109 bp)
LOCUS NM_001079624 1109 bp mRNA linear MAM 22-OCT-2017 DEFINITION Bos taurus ESX homeobox 1 (ESX1), mRNA. ACCESSION NM_001079624 XM_868141 VERSION NM_001079624.2 KEYWORDS RefSeq. SOURCE Bos taurus (cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...gene="ESX1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 464..622 /gene="ESX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1109) AUTHORS Zimin AV, Delcher AL, Florea L, Kelley...
NM_001079624.2 - Bos taurus (cattle) - NCBI
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus homeobox B5 (HOXB5), mRNA. (1453 bp)
synonym="Ghox-2.1; Hoxb-5" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..795 /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Ghox-2.1; Hoxb-5
NM_001025355.1 - Gallus gallus (chicken) - NCBI - UCSC
Bos taurus BARX homeobox 2 (BARX2), mRNA. (1836 bp)
LOCUS NM_001101266 1836 bp mRNA linear MAM 22-OCT-2017 DEFINITION Bos taurus BARX homeobox 2 (BARX2), mRNA. ACCESSION NM_001101266 XM_869733 VERSION NM_001101266.1 KEYWORDS RefSeq. SOURCE Bos taurus (cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="BARX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 677..838 /gene="BARX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(677..679,686..688,806..808,815..820,827..829) /gene="BARX2" /note="specific DNA base...
NM_001101266.1 - Bos taurus (cattle) - NCBI
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
box 1C; homeo box A5; homeobox protein HOXA5; homeobox protein Hox-1C" /codon_start=1 /product="homeobox protein Hox-A5" /protein_id="NP_001305348.1" /db_xref="CGNC:66000" /db_xref="GeneID:100858404" /translation="MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQYRDSASMHSGRYGYGYNGMDLSVGRSASTHFGASERARTYPANSTSASTEPRYSQSAAASHSPPPDPLPCTAVAASPVSESHHGVKNSLGNSSSTSSNSSSSTHISRDGVGTSSGTEEDTPASSEQASAPSDQSTAQPSQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP" misc_feature 502..>822 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="Homeobox protein; Region: Abdominal-A;...
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. (1822 bp)
LOCUS NM_001164980 1822 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_001164980 VERSION NM_001164980.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 355..474 /gene="tgif1" /gene_synonym="tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1822) AUTHORS Freeman,R.M. Jr., Wu,M., Cordonnier-...
Synonym: tgif
NM_001164980.1 - Saccoglossus kowalevskii - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (95 bp)
GeneID:8039835" /db_xref="VectorBase:ISCW012461" CDS 95 /locus_tag="IscW_ISCW012461" /note="encoded by transcript IscW_ISCW012461-RA" /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002413770.1" /db_xref="VectorBase:ISCW012461-PA" /db_xref="GeneID:8039835" /db_xref="VectorBase:ISCW012461" /translation="VDKYLSVSKRMELSATLNLTEVQIKTWFQNRR" misc_feature <4..95 /locus_tag="IscW_ISCW012461" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 95) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project TITLE Direct...
XM_002413725.1 - Ixodes scapularis (black-legged tick) - NCBI
Rattus norvegicus Rhox homeobox family member 9 (Rhox9), mRNA. (829 bp)
Rhox homeobox family member 9" /protein_id="NP_001020045.1" /db_xref="GeneID:298352" /db_xref="RGD:1563844" /translation="MDTPQDSCQSFQKSLSLGAEVDPEQQHGGTAVVSEAREVGDQSQRLVGGLVQGGLDQGQPTQGQLAGGNLPQEEPAELSLAQEATGVEEEGDEKEEEMEARYAGDGAYGPEDNNVQQEGDQHPNDQEQPQQEAAIPEGNRGQQAGNRLVHPRHTRPRFTHSQLRDLERLFQETRYPSLRTRKDLARWMGVPESDVQDWFRMRRSLFRRNSRLLMFCELPPIPENNPS" misc_feature order(462..476,480..482,531..533,549..551,588..590, 594..599,606..611,615..623,627..632) /gene="Rhox9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 468..629 /gene="Rhox9" /note="Homeobox domain;...
NM_001024874.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 01-OCT-2017 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus reproductive homeobox 10 (Rhox10), mRNA. (760 bp)
ME, Ramaiah M, Sridhar V, de Rooij DG, Orwig KE, Zhang K and Wilkinson MF. TITLE The Homeobox Transcription Factor RHOX10 Drives Mouse Spermatogonial Stem Cell Establishment JOURNAL Cell Rep 17 (1), 149-164 (2016) PUBMED 27681428 REMARK GeneRIF: RHOX10 drives mouse spermatogonial stem cell establishment. REFERENCE 2 (bases 1 to 760) AUTHORS Song HW, Dann CT, McCarrey JR, Meistrich ML, Cornwall GA and Wilkinson MF. TITLE Dynamic expression pattern and subcellular localization of the Rhox10 homeobox transcription factor during early germ cell development JOURNAL Reproduction...
NM_001024850.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
order(457..459,466..468,586..588,595..600,607..609) /gene="HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1263) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed chicken monoblastic leukaemia cells JOURNAL Leukemia 5 (5), 357-360 (1991) PUBMED 1674560...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. (2551 bp)
LOCUS NM_001164940 2551 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. ACCESSION NM_001164940 VERSION NM_001164940.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox9/10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1170..1331 /gene="hox9/10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1170..1172,1179..1181,1299..1301,1308..1313, 1320..1322) /gene="hox9/10" /note="...
NM_001164940.1 - Saccoglossus kowalevskii - NCBI
Rattus norvegicus Rhox homeobox family member 8 (Rhox8), mRNA. (738 bp)
LOCUS NM_001025776 738 bp mRNA linear ROD 19-JUL-2017 DEFINITION Rattus norvegicus Rhox homeobox family member 8 (Rhox8), mRNA. ACCESSION NM_001025776 XM_578961 VERSION NM_001025776.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...Rhox8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 361..519 /gene="Rhox8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001025776.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Ixodes scapularis homeobox protein, putative, mRNA. (201 bp)
db_xref="VectorBase:ISCW020382" CDS 1..201 /locus_tag="IscW_ISCW020382" /note="encoded by transcript IscW_ISCW020382-RA" /codon_start=1 /product="homeobox protein, putative" /protein_id="XP_002402536.1" /db_xref="VectorBase:ISCW020382-PA" /db_xref="GeneID:8033067" /db_xref="VectorBase:ISCW020382" /translation="MGRYFSTFQKEQLTKAFVCNAYPDTAQQRTLAFRLGLTTEQVKVWFANKRTRDRKRAVLFPELRLF" misc_feature 13..162 /locus_tag="IscW_ISCW020382" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 201) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project...
XM_002402492.1 - Ixodes scapularis (black-legged tick) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/en/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.156 | 0.156 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.503 | 0.347 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.509 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]