GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-02-19 16:53:34, GGRNA : RefSeq release 86 (Jan, 2018)



Matches are highlighted with green background. Overlapping matches are dark colored.

Caenorhabditis remanei CRE-TAG-80 protein (Cre-tag-80) mRNA, complete cds. (21927 bp)
position 1867
XM_003107901.1 - Caenorhabditis remanei - NCBI
Caenorhabditis elegans CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife (cla-1), partial mRNA. (25584 bp)
position 1741
NM_001307220.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Unclassified non-coding RNA ZK1193.9 (ZK1193.9), ncRNA. (133 bp)
AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA gaaggcgaccacgtcgtcgccaagaagagattgaagacgacgaatggagcgaaagtagtaaggaggggttgagggggggggaggtcgggatcgagatggcataatgtaggaaccggatggaagagtctaaaag
position 21
NR_070329.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Medicago truncatula Nodule Cysteine-Rich (NCR) secreted peptide partial mRNA. (165 bp)
International Medicago Genome Annotation Group TITLE Direct Submission JOURNAL Submitted (21-FEB-2014) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr., Rockville, MD 20850, USA atgatcttttatcatgttttaataacgttgttttgttatctttttttcattacaatacaatttctaccatctccatgtgaaactgatgatgattgtcaagaagagattggtgttagaaaaatatgtattcgtgaagtttgtagatattttgcaaagattcactga
position 97
XM_013598736.1 - Medicago truncatula (barrel medic) - NCBI
Caenorhabditis elegans CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife (cla-1), partial mRNA. (26769 bp)
position 1741
NM_001307219.2 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Polysphondylium pallidum PN500 40S ribosomal protein S30 (rps30-2), partial mRNA. (198 bp)
G., Schaap,P., Noegel,A.A., Felder,M. and Platzer,M. TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Genome Analysis, Fritz Lipmann Institute, Beutenbergstr. 11, Jena 07745, Germany atgggtaaggttcacggtggtttgaacagagctggtaaagtcagaaacgctactccaaacgttgagaagaaggaggtcagaaagccaaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcgttggtttcggaaagaagaagggttacaacactcaaaacgtcccaaatgtctaa
position 102
XM_020573799.1 - Polysphondylium pallidum PN500 - NCBI
PREDICTED: Helianthus annuus uncharacterized LOC110938512 (LOC110938512), ncRNA. (221 bp)
ncRNA 1..221 /ncRNA_class="lncRNA" /gene="LOC110938512" /product="uncharacterized LOC110938512" /db_xref="GeneID:110938512" ORIGIN // ctcaagtacggcgtgcaacaagtgcctacccacgtcgtcaaagaactcatcatgcacgaggtggtgcttgggggtggccaggatgcatctgctgttaccacaaccatcatcgtgcggggaagtttgaagccaaattttatgacaaggttctgcaagaagagattggaggcgttaaaggacatttcgggccaattaatgctttggcattcaacccggatgga
position 153
XR_002591448.1 - Helianthus annuus (common sunflower) - NCBI
Saccharomyces eubayanus RPL36B-like protein (DI49_5219), partial mRNA. (246 bp)
of Genetics, University of Wisconsin-Madison, 425-G Henry Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atgactccagctccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcatcagagccaaggctaaggtcgaggaaatgaacaacatcatcgctgcttctcgtcgtcattaa
position 162
XM_018368212.1 - Saccharomyces eubayanus - NCBI
Metarhizium robertsii ARSEF 23 Fungal transcriptional regulatory protein mRNA. (273 bp)
Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fenglin Road, Shanghai, Shanghai 200032, China atgattgctctcaagtcgtggaaaaagtctgaacgggtccgctgggacggaaataagcatagtcctgaggagacggctggcttgtttggtctcggtgccctttcatggcttaacccgctctcgttggcaggatacaagaagagattggccctagaggacttgtaccgcctcgattgcaacttggcatcagagcatctgcaggtcaatcacccgcctgtgtcaacagtctgcgcagtagccctgggaaacgttacggtctggccagagcgctga
position 135
XM_011412523.1 - Metarhizium robertsii ARSEF 23 - NCBI
Exophiala aquamarina CBS 119918 hypothetical protein partial mRNA. (288 bp)
Cambridge, MA 02142, USA atgccagacaatccacagtttcttggaccactactcccgcaacacattgccgaaaccatcaacgtcagcattggacccagtggcgagaacagggagtatctcttgcatctccaagatgccctagaagctctgagtgctcacagccatgacgaacatattgccgatctagcacgaagagtgcgtgctttggatccacctacgcggccggcatgtccttcttcaatcggccacgacttgaggaagattaacagcaccgaagaacaagaagagattgagaaggatacatga
position 262
XM_013407183.1 - Exophiala aquamarina CBS 119918 - NCBI
PREDICTED: Papilio machaon 40S ribosomal protein S4-A-like (LOC106708482), partial mRNA. (348 bp)
position 316
XM_014500008.1 - Papilio machaon (common yellow swallowtail) - NCBI
Scheffersomyces stipitis CBS 6054 60S ribosomal protein L36 partial mRNA. (288 bp)
US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA ggaattgctgttggattaaacaagggtcacaagactaccgctaaggaagttgctccaaagatctcttacagaaagggtgctctttccaagagaaccgacttcgtcagaaacatcgtcaaggaagttgctggcttagccccatacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagaaatgaacaaggtcattgctgaaaccagaagacactaa
position 204
XM_001383429.1 - Scheffersomyces stipitis CBS 6054 (Pichia stipitis CBS 6054) - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (297 bp)
Acytostelium Genome Consortium TITLE Direct Submission JOURNAL Submitted (05-SEP-2014) Contact:Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan ggtcagaaacgctactccaaacgtggagaagaaggagacccgcaagtccaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcaccggtttcggaaagaagaagggatacaacacccagaacgttccaaatgtctaagcaacatagtagcgtcgcgtccgtccctcagtagtcccgtgcctctccgctcattgcaacactggacactcgatcacggaggccagtcggtcctcaacagcccgtctgtcctccacgtaaataaacaaccggctttc
position 64
XM_012897535.1 - Acytostelium subglobosum LB1 - NCBI
Saccharomyces cerevisiae S288c ribosomal 60S subunit protein L36B (RPL36B), partial mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagccccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatatgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
position 219
NM_001184312.1 - Saccharomyces cerevisiae S288C - NCBI
Saccharomyces cerevisiae S288c ribosomal 60S subunit protein L36A (RPL36A), partial mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa
position 219
Synonym: RPL39B
NM_001182701.1 - Saccharomyces cerevisiae S288C - NCBI
Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 ribosomal protein L36e (METBIDRAFT_76691), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggcccaaaccggtattgctgtcggtttgaacaagggtcacaaaaccacccaaaaggaagttgttccaagactttcccgcaagaagggagtcttgtccaagagagctgctttcgtcagaagcattgtctctgaggtctccggcttggccccatacgagagaagattgatcgagttgatcagaaacgccagcgagaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgagaaaggttgaggagatgaacaagatcattgctgagtctaagagacactaa
position 216
XM_018858572.1 - Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 - NCBI
Caenorhabditis elegans Uncharacterized protein (F29B9.11), partial mRNA. (267 bp)
Genome Institute at Washington University, St. Louis, MO 63110, USA atgctgaaccgtgctgtgctctccttggctagaagccaacatgtcatccgtcgctcgcttcacaagggagttgactcgaccccaccactccgtttcacctctgtcagcgagaaggttgccctttacggactcatctgcgtcgctttcatggcatacccaacttccgtcctcttcagacttgatagtcttcgcccaagaccggataatgctctctccccagaagtccaagaagagattgacgcccgtgttgccgcccgcagacagtag
position 226
NM_068208.6 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Saccharomyces eubayanus RPL36A-like protein (DI49_4277), partial mRNA. (303 bp)
Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atggccgctaagacaggaatcgcaattggtttgaacaaaggtaagaaggtcactagcatgaccccagccccaaagatctcttacaagaagggtgctgcttccaacagaactaagttcgtcagatctttggttagagaaatcgccggtttgtctccatacgaaagaagattgatcgatctaataagaaactctggtgaaaagagagctagaaaggttgccaagaagagattgggttctttcatcagagccaaggctaaggttgaagaaatgaacaacattatttctgcttctcgtcgtcactaa
position 219
XM_018367307.1 - Saccharomyces eubayanus - NCBI
Kazachstania naganishii CBS 8797 hypothetical protein (KNAG0D00710), partial mRNA. (303 bp)
of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND atggccgtcaagactggtattgctgttggtttgaacaagggtaagcaggtcaatgctatgaccccagccccaaagatgtcctacaagaagggtgccatctctaacagaacccagttcgtccgctcgctggtgaaggagatcgctggtctgtccccatacgaaagaagactgatcgacttgatcagaaactctggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaagagagccaaggccaaggttgaggagatgaacaacgtcatcgctgcctctcgtcgtcattga
position 219
XM_022607478.1 - Kazachstania naganishii CBS 8797 - NCBI
[Candida] glabrata 60S ribosomal protein L36 (CAGL0K10906g), partial mRNA. (303 bp)
Paris Cedex 15, FRANCE. E-mail: atggccgttaagactggtattgctgttggtttgaacaagggtactaaggtcacccaaatgaccccagccccaaagatctcttacaagaagggtgctgcttctaacagaaccaagttcgttcgttctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagctaaggctaaggttgaagaaatgaactccatcattgctgcttctcgtcgtcactaa
position 219
XM_002999537.1 - [Candida] glabrata (Candida glabrata) - NCBI
Eremothecium gossypii ATCC 10895 60S ribosomal protein L36 (AGOS_AFL163C), partial mRNA. (303 bp)
Biozentrum, Klingelbergstrasse 50, Basel CH-4056, Switzerland atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaccccaatgacccctgctccaaaggtctcttacagaaagggtgcctcctccaagagaaccaccttcgtcagatctatcgtcagagaggttgccggcatggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggcacctttggcagagctaaggctaaggttgaggaaatgaacgagatcattgctgcttctagacgtcactag
position 219
NM_210741.1 - Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895) - NCBI
Tetrapisispora blattae CBS 6284 hypothetical protein (TBLA0A02360), partial mRNA. (303 bp)
of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND atggctgtcaaaactggtattgctgttggtttgaacaaaggtaagcaggtcgtctctatgaccccagctgccaagatctcatacaagaagggccaatcttctcaaagaaccaagttcgtcagatctttggtcagagaaatcgctggtttagctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggttgaagaaatgaacaacatcattgctgcctctcgtcgtcattag
position 219
XM_004177506.1 - Tetrapisispora blattae CBS 6284 - NCBI
Lachancea thermotolerans CBS 6340 60S ribosomal protein L36 partial mRNA. (303 bp)
FRANCE (E-mail : - Web : atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcacccagatgaccccagccccaaagatctcgtacagaaagggtgcttcctctaacagaaccaagttcgtcagatctttggtcaaggaggtcgccggtttggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggtactttcggcagagccaaggctaaggtcgaggagatgaacgacatcatcaccgcctctcgtcgtcactaa
position 219
XM_002555947.1 - Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS - NCBI
Eremothecium cymbalariae DBVPG#7215 Hypothetical protein partial mRNA. (303 bp)
Laboratory, Gamle Carlsberg Vej 10, Copenhagen V DK-1899, Denmark atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaactcgatgaccccagccccaaagatctcttacagaaagggtgcttcttccaagagaacggagtttgttagatctattgtcaaggaagtcgccgggttggctccatacgagagaagattgcttgatttgatcagaaactctggtgagaagagagccagaaaggttgccaagaagagattgggtacttttggcagagcaaaggctaaggttgaagaaatgaacaacgtcattgctgcttccagacgtcactga
position 219
XM_003644656.1 - Eremothecium cymbalariae DBVPG#7215 - NCBI
PREDICTED: Prunus persica uncharacterized LOC109948414 (LOC109948414), ncRNA. (315 bp)
including 8 samples with support for all annotated introns" /db_xref="GeneID:109948414" ncRNA 1..315 /ncRNA_class="lncRNA" /gene="LOC109948414" /product="uncharacterized LOC109948414" /db_xref="GeneID:109948414" ORIGIN // gcaaagtcgacagtaatgtgcaacaatcaagagttggccgagatgcattttttaatttcatgtacaagaagagattgctaataaatggaggaaattaaaccttaaagagaaggctacatatggttctgccttggaaggttcgagtgggccaaggattaaaatatcaaccatgtaaataatatagggcctccaatttacggatatttcgggggatatattattatcgtcttaggtatcggaaaaaagaagaagacagatataggtattgaaacacataattttggtataaaactttcattaatgttatgtacatta
position 65
XR_002271033.1 - Prunus persica (peach) - NCBI
Kuraishia capsulata CBS 1993 uncharacterized protein (KUCA_T00004322001), partial mRNA. (318 bp)
position 234
XM_022601045.1 - Kuraishia capsulata CBS 1993 - NCBI
Lachancea lanzarotensis LALA0S05e07514g1_1 (LALA0_S05e07514g), partial mRNA. (303 bp)
UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850, France atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcaacgccatgaccccaaccccaaagatctcctacagaaagggtgcttcttccaacagaaccaagttcgtcagatctttggtcaaggaagttgccggtttggccccatacgaaagaagattgatcgatttgatcagaaacgctggtgaaaagagagccagaaaggtggccaagaagagattgggtaccttcggcagagccaaggccaaggtcgaggagatgaacgacatcatcaccgcttctcgtcgtcattaa
position 219
XM_022772423.1 - Lachancea lanzarotensis - NCBI
Komagataella phaffii GS115 60S ribosomal protein L36 (PAS_FragB_0036), partial mRNA. (306 bp)
/ Gent University, Technologiepark 927, Ghent, 9052, BELGIUM atgagaaatattgtactaacaaattcaggtattgcagtaggtgctaacaagggacacaaggtcaccccaaaggccgttgctccacaaaagagagtcgctatcagccaaagaactgactttgttagaaagttggtccgtgaggtcactggtctgtctccatacgaaagaagaatcattgagttgatcagaaactctggtgagaagagagccagaaagttcgccaagaagagattgggtactcacaccagagctaaggctaagttggaagagatgcaaaacgttatccaggaagcaaagcgtcattaa
position 222
XM_002490801.1 - Komagataella phaffii GS115 - NCBI
PREDICTED: Solanum tuberosum F-box/LRR-repeat protein At3g48880-like (LOC107062341), mRNA. (420 bp)
translation="MSFPKQEEIEVVVMEEGTSPVRIWEDLNIDMLVKIFQSFDLFQLISVIPQVCHAWQSACSDQHLWKTLDLSIMKSNFIRVSIPPYIYVDTPSREKLNRILKICLILSHGNKLTLIFHYNLYVDNNQLTYSAKRYSPNKL" misc_feature 70..213 /gene="LOC107062341" /note="F-box-like; Region: F-box-like; pfam12937" /db_xref="CDD:289689" ORIGIN // atgtcgtttccaaaacaagaagagattgaagttgttgtgatggaagaaggaacttctcctgtaaggatatgggaggaccttaatattgatatgctggtgaagatattccaatcctttgaccttttccagttgatctctgtcattcctcaagtttgtcatgcatggcaatcggcttgttctgaccaacatctttggaaaacgctggacttgtcaataatgaagtcaaatttcatcagagtttcaataccgccgtatatatatgttgacactccatctcgtgaaaaattgaaccgcatcctaaagatttgcttgatccttagtc...
position 16
XM_015312875.1 - Solanum tuberosum (potato) - NCBI
PREDICTED: Limulus polyphemus uncharacterized LOC111086280 (LOC111086280), ncRNA. (365 bp)
product="uncharacterized LOC111086280" /db_xref="GeneID:111086280" ORIGIN // gtggaatgaaatcagatttgaatttaaccacctgagcaaactactactttgaatgataagaatgaaccatcactactggaaacgttataccgaagcaaggatactctggaaaccatatttaggtttatcgatagagatgggtcaggtcttatctccatggaagaatttacagatgcatgccatctactaagtcaacacttagggacagctatgtcacaagaagagattgatgatttggccaagagtatagacattaacaaagacggatttattgatttcaatgagtttttggaagccttccgtcttgtagacaaggagccctcccctgtattacaggcaagagagtaaacattgttcttgtggta
position 217
XR_002611008.1 - Limulus polyphemus (Atlantic horseshoe crab) - NCBI
PREDICTED: Dendroctonus ponderosae bis(5'-adenosyl)-triphosphatase-like (LOC109546646), mRNA. (376 bp)
misc_feature order(171..173,177..179,183..191) /gene="LOC109546646" /note="HIT family signature motif; other site" /db_xref="CDD:238263" misc_feature 177..179 /gene="LOC109546646" /note="catalytic residue [active]" /db_xref="CDD:238263" ORIGIN // tggtatccactataagacgagtacagaggctgcatgacatgacccaagaagagattgctgatcttttccagaccgccgttaaaatttctaaaattatggaagcggcttaccaagccgcatcaagcacggtttgtgtccaggatggcgaatatgccggccaaactgccccgcaagtgcacgtgcatattttaccacgcaaaaagggcgactttgccaacaatgacgatatttattcgcgtctggccgaccaggacagagacaccaatccgacgtccagaagaacactggaggaacaagtggaagaagccgcttatctaagaacgttttttctttgatcagtgtgaaatttgttg...
position 45
XM_019917686.1 - Dendroctonus ponderosae (mountain pine beetle) - NCBI
PREDICTED: Halyomorpha halys uncharacterized LOC106684563 (LOC106684563), transcript variant X2, mRNA. (450 bp)
db_xref="GeneID:106684563" /translation="MERHRLNIDEVMDIVKNEKLPEDKEKQCFVGCTMNNLGYVKDLILDWNEVKKTNPEKFDTPEEVEKANTVADACAKTVSGKHPSLCELGVRAIKCMHQESQKIKLPIPDFSFD" misc_feature <67..339 /gene="LOC106684563" /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395" /db_xref="CDD:279703" ORIGIN // cctgtatacaagaagagattgctatcatcattgaccgattgtatggaaaggcatcgattaaatatagatgaggttatggatatagtaaaaaacgaaaaacttcctgaggataaagaaaagcagtgtttcgttggctgtaccatgaacaatctgggatatgtaaaggatttaatattggattggaatgaggtaaagaagactaatcctgaaaaatttgatacacctgaagaagttgagaaggcaaacacagttgccgatgcttgcgctaaaacggtgtctggaaagcatccaagcctctgtgaactgggagtaaggg...
position 9
XM_014426725.1 - Halyomorpha halys (brown marmorated stink bug) - NCBI
PREDICTED: Homo sapiens uncharacterized LOC105371333 (LOC105371333), transcript variant X2, ncRNA. (415 bp)
for all annotated introns" /db_xref="GeneID:105371333" ncRNA 1..415 /ncRNA_class="lncRNA" /gene="LOC105371333" /product="uncharacterized LOC105371333, transcript variant X2" /db_xref="GeneID:105371333" ORIGIN // ccagggtggactgaggctggagcgtgcgacctcagccgcgggtgggcgtcaggggcgaccccggagcgaggggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacgatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacattgagcctcacctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggagatgaagaggggctgattaagaggagctgactgaggctgggaggtttcctgcccgggagtggcgagcctgtcagagctgcacctgggcctacctgtacctaggagagatt...
position 77
XR_917446.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens uncharacterized LOC105371333 (LOC105371333), transcript variant X2, ncRNA. (415 bp)
variation complement(383) /gene="LOC105371333" /replace="c" /replace="g" /db_xref="dbSNP:954102599" variation complement(395) /gene="LOC105371333" /replace="a" /replace="g" /db_xref="dbSNP:73589841" ORIGIN // ccagggtggactgaggctggagcgtgcgacctcagccgcgggtgggcgtcaggggcgaccccggagcgaggggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacgatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacattgagcctcacctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggagatgaagaggggctgattaagaggagctgactgaggctgggaggtttcctgcccgggagtggcgagcctgtcagagctgcacctgggcctacctgtacctaggagagattcag...
position 77
XR_933716.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Spathaspora passalidarum NRRL Y-27907 hypothetical protein (SPAPADRAFT_55114), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggctaagtcaggtattgctgctggtttaaacaagggtcacaagactaccgctaaggaagtcgctccaaaggtttcctacagaaagggtgctttaagtaagagagctgactttgtcagaaacatcgtcaaggaagttgctggtttagccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagctttaagaaaggttgaagaaatgaacaaggtcattgctgaatctagaagacactaa
position 216
XM_007374654.1 - Spathaspora passalidarum NRRL Y-27907 - NCBI
PREDICTED: Prunus persica uncharacterized LOC109949103 (LOC109949103), ncRNA. (395 bp)
product="uncharacterized LOC109949103" /db_xref="GeneID:109949103" ORIGIN // tgtgatgttgtggtgtttacgggggtgggggtattaggctttggattagtattcaaattctcggcgctatagacaattgcatgatagtgttttgtacttgatttgtgcaagttatggaagctcaaaaaaggggatcaacaaaaggaaagcgcaaagtcgacagtaatgtgcaacaatcaagagttggccgagatgcattttttaatttcatgtacaagaagagattgctaataaatggaggaaattaaaccttaaagagaaggctacatatggttctgccttggaaggttcgagtgggccaaggattaaaatatcaaccatgtaaataatatagggcctccaatttacggatatttcgggggatatattattatcgtcttaggtatcggaaaaaa
position 215
XR_002271587.1 - Prunus persica (peach) - NCBI
PREDICTED: Drosophila biarmipes uncharacterized LOC108029766 (LOC108029766), mRNA. (433 bp)
xref="GeneID:108029766" /translation="MASATSSSARHLFDESKKRLCARVGVNVNNLGSVARQVVRGSKSNEIMHQTLKNFTQVDVVSEYSHQNLQKMTLILQHVGYQYDVMQDSVNHLDYLKEQVTAMER" ORIGIN // ttaaatattttatctcagctgtttctccctgactttgtttacaattagcgagtttattaacatttaaacagcgttaaaccataaataaaatggcctctgcgaccagttcaagtgctcgacatttattcgacgagtccaagaagagattgtgtgcccgcgtgggtgtaaacgtgaataatttgggatctgtggcccgacaggttgtcaggggctccaagagcaacgagatcatgcatcaaaccctgaagaacttcacccaagtggacgtggtctcggaatacagccaccagaatctgcagaagatgacgctgatcctgcagcacgtgggctaccagtacgatgtgatgcaggatagtgtcaaccacttggattacctcaaggagcaggtgacggccatggaaagatgattggaagagcaaaagcctagacacta
position 137
XM_017102272.1 - Drosophila biarmipes - NCBI
PREDICTED: Homo sapiens uncharacterized LOC105371333 (LOC105371333), transcript variant X1, ncRNA. (437 bp)
introns" /db_xref="GeneID:105371333" ncRNA 1..437 /ncRNA_class="lncRNA" /gene="LOC105371333" /product="uncharacterized LOC105371333, transcript variant X1" /db_xref="GeneID:105371333" ORIGIN // tgaggcagctgttggagagggatgggtcaagggatggagggtagcactgtgagctgaaataggtgaattgggagggatgctggctagagaagaggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacgatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacattgagcctcacctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggagatgaagaggggctgattaagaggagctgactgaggctgggaggtttcctgcccgggagtggcgagcctgtcagagctgcacctgggcctacctgtacctaggaga...
position 99
XR_917445.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens uncharacterized LOC105371333 (LOC105371333), transcript variant X1, ncRNA. (437 bp)
gene="LOC105371333" /replace="c" /replace="g" /db_xref="dbSNP:954102599" variation complement(417) /gene="LOC105371333" /replace="a" /replace="g" /db_xref="dbSNP:73589841" ORIGIN // tgaggcagctgttggagagggatgggtcaagggatggagggtagcactgtgagctgaaataggtgaattgggagggatgctggctagagaagaggaggcaagaagagattgaagggaaatctcaaggggctccagagactactacgatggtgcaaagtcacagaagccctgggaaaagcaggtagaatggagttgccatgacattgagcctcacctagatgccagttccagatattggcagactgctggcctcctgaggagcacaggaaggggcctggcagactggtgatcctggttggagatgaagaggggctgattaagaggagctgactgaggctgggaggtttcctgcccgggagtggcgagcctgtcagagctgcacctgggcctacctgtacctaggagagattcagggtat...
position 99
XR_933715.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Capsicum annuum uncharacterized LOC107858853 (LOC107858853), mRNA. (438 bp)
ORIGIN // atgaatggagtagttaaagctgcaaatcttaattatggtggatattgcaccacaattagaacttctactggggaaactccctacatgttggtttatgggtcggaagcagtgatacctacagaagtagagataccttcattgagagtcattcaggaggttggtctagatgacgttgaatggattcatagtagaatcgagcagttgatgctcattgacaagaagagattggatgcggtttgtcatggtcaactctatcaaaatagaatgatcaaggcgttcaacaagaaagtcaagcctcgtcgattcacaccaggacaattagtattgaagaagatattccctcaccaagatgaagccaaaggaaaatttgtgccaaattggcaaggtccttacatagttcaccgagtactctcaggaggagcagtgatcctcgcataa
position 216
XM_016703657.1 - Capsicum annuum - NCBI
PREDICTED: Cricetulus griseus uncharacterized LOC103163642 (LOC103163642), transcript variant X2, ncRNA. (439 bp)
transcript variant X2" /db_xref="GeneID:103163642" ORIGIN // ttgtacttgtggtatagactgctgcatgctggctggctaggttgctctttttaacttagaaagttgaggaaacaacaaagtagaggatgaatggtatctggaggttgacatactgatactcggggaaggtacagatgtgaatttcagcatgaagaaaggaagatattttctgttgttcaaggatgagacataccatatgagagggagccactataggtccaagaagagattgggaccatggagatttccagagacctacaaggatgacatgatctcataatcaaggcaatggtggagaggataacctaaaagccctcccctaaaatgagattgatgatttctctttatgccatcctagagcactcatccagtggctgatggaagcagatacagacatccacagatatacactgagctgaaattgggaatttagttgaag
position 220
XR_481632.1 - Cricetulus griseus (Chinese hamster) - NCBI
Caenorhabditis remanei hypothetical protein (CRE_18336) mRNA, partial cds. (2351 bp)
position 1624
XM_003089063.1 - Caenorhabditis remanei - NCBI
PREDICTED: Pongo abelii uncharacterized LOC100448557 (LOC100448557), ncRNA. (322 bp)
position 285
XR_653668.1 - Pongo abelii (Sumatran orangutan) - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (411 bp)
Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan tcaactggagtcaaacttgcaaacaattgtatggagattttcgatcagatgaagattcgtcgtcaatatggaatagtcttttataagttgaacgatgacaatactcagattgtggtcgagaagactttaccatatggatcaccattcactactttcctcaccgagctacctcccactgaatgtagatacgtcttagttgactttgcctacaccgaagagtcaacctccaagaagagattggtgttcgtctcatggtgtccaggtacatcaagtattagaagtagaatgatatatactgcttcaaaggatgcacttcgcaaggcattggttggtatccaaactgaggtccaaggttgtgatatatctgaggtccaagaggaacaattccttgagaagatcacgaggttgtag
position 228
XM_012898411.1 - Acytostelium subglobosum LB1 - NCBI
PREDICTED: Brassica napus uncharacterized LOC111205670 (LOC111205670), ncRNA. (360 bp)
ncRNA 1..360 /ncRNA_class="lncRNA" /gene="LOC111205670" /product="uncharacterized LOC111205670" /db_xref="GeneID:111205670" ORIGIN // aatgagaatttaaagtttacagattttgtttaatattgagctataaatggtatatacaaaaacaggggtataaactattaagaggcttctctctagcaaatgaaaaaaatccagtaaaggtttttcttttttttttttgtgcacaagaagagattgaagccaagaaaaaaaaacccagaaacttcctttgaggaaattcaaatctgaaaaaaaaacaaagaaaacagtttcctgataattaaaaatcaaaccaaaagaagagaagttttctaagagataatttgtttttctttcttttctctttttttttggtttggttccttgtgctatcagtctattacaatccaatagaaaagagaa
position 144
XR_002658213.1 - Brassica napus (rape) - NCBI
PREDICTED: Calypte anna zinc finger protein 420-like (LOC103535473), partial mRNA. (1339 bp)
position 494
XM_008501529.1 - Calypte anna (Anna's hummingbird) - NCBI
Saccharomyces cerevisiae S288c ribosomal 40S subunit protein S23A (RPS23A), partial mRNA. (438 bp)
submitter REFERENCE 7 (bases 1 to 438) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atgggtaaaggtaagccaagaggtttgaactctgctagaaagctacgtgtccacagaagaaacaaccgttgggccgaaaacaactacaagaagagattgttgggtactgccttcaagtcttctccattcggtggttcttctcatgccaagggtatcgtcttggaaaaattgggtatcgaatccaagcaacctaactctgctatcagaaagtgtgttagagttcaattaatcaagaacggtaagaaggtcactgctttcgttccaaacgatggttgtttgaactttgtcgacgaaaatgatgaagtcttgctagcaggtttcggtagaaagggtaaagctaagggtgatattccaggtgttagattcaaggtcgttaaggtctctggtgtctcc...
position 87
NM_001181247.3 - Saccharomyces cerevisiae S288C - NCBI
Cyberlindnera jadinii NRRL Y-1542 ribosomal protein S12/S23 partial mRNA. (438 bp)
H.P., Cantor,M.N. and Hua,S.X. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (23-FEB-2016) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atgggtaagggtaagccaagaggtttgaactccgctagaaagttgagagtccacagaagaaacaaccgttgggctgaacaatcttacaagaagagattgttgggaactgctttcaagtcctctccattcggtggttcttctcacgctaagggtatcgtcttggaaaagattggtattgagtccaagcaaccaaactctgctatcagaaagtgtgtcagagttcaattgatcaagaacggtaagagagttactgctttcgttccaaacgatggttgtttgaacttcgtcgatgagaacgatgaagttttgcttgctggtttcggtagaaagggtaaggctaagggtgatatcccaggtgtcagattcaaagtcgtcaaggtttctggtgtctccttg...
position 87
XM_020212990.1 - Cyberlindnera jadinii NRRL Y-1542 (anamorph: Candida utilis NRRL - NCBI
PREDICTED: Cucumis melo cytoplasmic tRNA 2-thiolation protein 1-like (LOC103490070), mRNA. (471 bp)
position 418
XM_008449439.1 - Cucumis melo (muskmelon) - NCBI
PREDICTED: Peromyscus maniculatus bairdii prefoldin subunit 4-like (LOC102907957), mRNA. (472 bp)
position 286
XM_006984001.2 - Peromyscus maniculatus bairdii (prairie deer mouse) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.076 | 0.076 | count_done;
0.147 | 0.072 | search_done;,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.152 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]