2024-04-29 12:49:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_033913633 303 bp mRNA linear PLN 28-APR-2020 DEFINITION Saccharomyces paradoxus Gyp5 (SPAR_P00270), partial mRNA. ACCESSION XM_033913633 VERSION XM_033913633.1 DBLINK BioProject: PRJNA625777 BioSample: SAMEA2757769 KEYWORDS RefSeq. SOURCE Saccharomyces paradoxus ORGANISM Saccharomyces paradoxus Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 303) AUTHORS Yue,J.X., Li,J., Aigrain,L., Hallin,J., Persson,K., Oliver,K., Bergstrom,A., Coupland,P., Warringer,J., Lagomarsino,M.C., Fischer,G., Durbin,R. and Liti,G. TITLE Contrasting evolutionary genome dynamics between domesticated and wild yeasts JOURNAL Nat. Genet. 49 (6), 913-924 (2017) PUBMED 28416820 REFERENCE 2 (bases 1 to 303) AUTHORS Yue,J.-X. TITLE Population-level Yeast Reference Genomes JOURNAL Unpublished REFERENCE 3 (bases 1 to 303) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-APR-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 4 (bases 1 to 303) AUTHORS Yue,J.-X. and Liti,G. TITLE Direct Submission JOURNAL Submitted (20-JAN-2020) Biotechnology, Delft University of Technology, van der Maasweg 9, Delft, Netherlands 2629 HZ, Netherlands REMARK Annotation added by submitter REFERENCE 5 (bases 1 to 303) AUTHORS Yue,J.-X. TITLE Direct Submission JOURNAL Submitted (04-FEB-2017) Institute for Research on Cancer and Aging, Nice (IRCAN), Institute for Research on Cancer and Aging, Nice (IRCAN), 28 Avenue de Valombrose, Nice, PACA 06107, France COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_047502). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..303 /organism="Saccharomyces paradoxus" /mol_type="mRNA" /strain="CBS432" /type_material="culture from neotype of Saccharomyces paradoxus" /db_xref="taxon:27291" /chromosome="XVI" gene <1..>303 /locus_tag="SPAR_P00270" /db_xref="GeneID:54633969" CDS 1..303 /locus_tag="SPAR_P00270" /note="GTPase-activating protein (GAP) for Rab family members; similar to YPL249C" /codon_start=1 /product="Gyp5" /protein_id="XP_033769524.1" /db_xref="GeneID:54633969" /translation="
MAVKTGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"
misc_feature 13..297 /locus_tag="SPAR_P00270" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:426088" ORIGIN
atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagctccaaagatctcctacaagaagggtgctgcctctaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]