ver.2
Help
|
Advanced search
|
Japanese
Previous release (v1)
2019-02-19 01:14:33, GGRNA : RefSeq release 92 (Jan, 2019)
Summary:
Results:
Matches are highlighted with green background.
Overlapping matches are dark colored.
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated...
XM_024651321.1 -
Strongyloides ratti -
NCBI
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 -
Strongyloides ratti -
NCBI
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not...
XM_024650915.1 -
Strongyloides ratti -
NCBI
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_001263935.1 -
Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) -
NCBI
misc_feature 832..1170 /locus_tag="Bm1_18705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(979..981,1024..1026,1051..1053,1063..1065, 1117..1119,1138..1140,1144..1146) /locus_tag="Bm1_18705" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN // REFERENCE...
XM_001895163.1 -
Brugia malayi -
NCBI
alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GeneID:103524044" /translation="MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC" misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the...
XM_008489050.1 -
Diaphorina citri (Asian citrus psyllid) -
NCBI
introns" /db_xref="GeneID:103630173" CDS 263..859 /gene="LOC103630173" /codon_start=1 /product="protein argonaute 1B" /protein_id="XP_020395108.1" /db_xref="GeneID:103630173" /translation="MGLSLNIDMSSTAFIEPLPMIDFVAQLLNRDILVRPLSDSDRVKIKKTLRGVKVEVTHRGNMRRKYRISGLTSQATRELSFPVDDRGTVKTVVQYFMETYGFSIQHTTLPCLQVGNQQRPNYLPMEVCKIVEGQRYSKRLNEKQITSLLKVTCQRPQERELDILQDSGSHQVTPPHHDDFADKCLNSSGGATNNNLMS" misc_feature 311..655 /gene="LOC103630173" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_020539519.1 -
Zea mays -
NCBI
product="protein argonaute 1B" /protein_id="XP_008675332.1" /db_xref="GeneID:103651475" /translation="MCREHKKTDVQSILVTADILAGRQADAPQEALQVLDIVLRELPTARYSPVGRSFYSPNLGRRQKLGEGLESWRGFYQSIRPTQMGLSLNIDMSSTAFIEPLPVIDFVAQLLNRDISVRPLSDSDRVKIKKALRGVKVEVTGNMRRKYHISGLTSQATRELSFPVDDRGTVKTVVQYFMETYGFSIQHTTLPCLQVGNQQRPNYLPMEVCKIVEGQHYSKRLNEKQITALLKVTCQRPQERELDILQDSGSHQVTPPPHDDFADKCLHSSGGAMNNNPMS" misc_feature 321..470 /gene="LOC103651475" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 471..809 /gene="LOC103651475" /note="PAZ domain, argonaute_like subfamily....
XM_008677110.3 -
Zea mays -
NCBI
ago4; argonaute-4; Argonaute4; eif2c4" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 141..554 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 588..737 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 738..1100 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="PAZ domain, argonaute_like...
Synonym: ago4;
argonaute-4;
Argonaute4; eif2c4
NM_001096105.1 -
Xenopus laevis (African clawed frog) -
NCBI
codon_start=1 /product="Protein argonaute-2" /protein_id="XP_024500654.1" /db_xref="GeneID:36373813" /db_xref="InterPro:IPR003100" /db_xref="UniProtKB/TrEMBL:A0A090KV99" /translation="MNSQLFFLSIVALEKKNVCRFALSKANELSGNFGNDKLFYAYDGVKNLITNHLLNIDEFVIEREKLGIQYKSIFKNGSVRIFFEKTTRYHEIDLSVYASYLIVTQQALNDKNAGGGGYVQLNGEKSLTESSSFLKYENLRIGLGRIIVGSFTENIKFTNIDEPCFVLSINASKNVYYKSELLDKIIKDEIFRRNVPRLLKDFNAEINDSNIKGVHFETVYRKNGDIIKFRHDLHNHSTIDTIIDMKDGSQKSFAEYFQNKFNIQLKYPVWPLFVYKIHVTN" misc_feature 565..828 /locus_tag="SRAE_56900" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
XM_024646477.1 -
Strongyloides ratti -
NCBI
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2352 /gene="AGO16204" /locus_tag="LACBIDRAFT_315429" /db_xref="GeneID:6074035" CDS 1..2352 /gene="AGO16204" /locus_tag="LACBIDRAFT_315429" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001878380.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6074035" /translation="...
XM_001878345.1 -
Laccaria bicolor S238N-H82 -
NCBI
Qualifiers source 1..2898 /organism="Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2898 /locus_tag="LACBIDRAFT_295925" /db_xref="GeneID:6085310" CDS 1..2898 /locus_tag="LACBIDRAFT_295925" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001889672.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6085310" /translation="...
XM_001889637.1 -
Laccaria bicolor S238N-H82 -
NCBI
misc_feature 16..2415 /locus_tag="CRE_14480" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 73..468 /locus_tag="CRE_14480" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 499..651 /locus_tag="CRE_14480" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 652..1014 /locus_tag="CRE_14480" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003107282.1 -
Caenorhabditis remanei -
NCBI
misc_feature 79..2424 /locus_tag="CRE_08398" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 79..477 /locus_tag="CRE_08398" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 508..672 /locus_tag="CRE_08398" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 676..1041 /locus_tag="CRE_08398" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003101857.1 -
Caenorhabditis remanei -
NCBI
misc_feature 73..2559 /locus_tag="CRE_09584" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 157..573 /locus_tag="CRE_09584" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 604..774 /locus_tag="CRE_09584" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 775..1140 /locus_tag="CRE_09584" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003103769.1 -
Caenorhabditis remanei -
NCBI
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2715 /gene="AGO16202" /locus_tag="LACBIDRAFT_311854" /db_xref="GeneID:6072122" CDS 1..2715 /gene="AGO16202" /locus_tag="LACBIDRAFT_311854" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001876710.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6072122" /translation="...
XM_001876675.1 -
Laccaria bicolor S238N-H82 -
NCBI
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2766 /gene="AGO16205" /locus_tag="LACBIDRAFT_311445" /db_xref="GeneID:6072513" CDS 1..2766 /gene="AGO16205" /locus_tag="LACBIDRAFT_311445" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001876972.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6072513" /translation="...
XM_001876937.1 -
Laccaria bicolor S238N-H82 -
NCBI
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2886 /gene="AGO16201" /locus_tag="LACBIDRAFT_317035" /db_xref="GeneID:6074423" CDS 1..2886 /gene="AGO16201" /locus_tag="LACBIDRAFT_317035" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001878739.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6074423" /translation="...
XM_001878704.1 -
Laccaria bicolor S238N-H82 -
NCBI
misc_feature 362..2929 /gene="LOC101259671" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 362..793 /gene="LOC101259671" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 824..973 /gene="LOC101259671" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 974..1318 /gene="LOC101259671" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
NM_001302909.1 -
Solanum lycopersicum (tomato) -
NCBI
to a group of related gene-silencing mechanisms mediated by short RNA molecules, including siRNAs, miRNAs, and heterochromatin-related guide RNAs. The central component...; Region: Piwi-like; cl00628" /db_xref="CDD:321081" misc_feature 34..378 /gene="LOC103632991" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature...
XM_008654693.2 -
Zea mays -
NCBI
misc_feature 58..2628 /locus_tag="CNBJ2880" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 58..537 /locus_tag="CNBJ2880" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 577..723 /locus_tag="CNBJ2880" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 847..1143 /locus_tag="CNBJ2880" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_767919.1 -
Cryptococcus neoformans var. neoformans B-3501A -
NCBI
misc_feature 72..413 /gene="LOC100926128" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(207..209,252..254,294..296,306..308,360..362, 381..383,387..389) /gene="LOC100926128" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 546..1643 /gene="...
XM_023500168.1 -
Sarcophilus harrisii (Tasmanian devil) -
NCBI
misc_feature 109..2664 /locus_tag="CNBJ3030" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 109..588 /locus_tag="CNBJ3030" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 628..774 /locus_tag="CNBJ3030" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 910..1203 /locus_tag="CNBJ3030" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_767934.1 -
Cryptococcus neoformans var. neoformans B-3501A -
NCBI
LOCUS XM_013436821 2136 bp mRNA linear INV 12-AUG-2015 DEFINITION Necator americanus PAZ domain protein partial mRNA. ACCESSION XM_013436821 VERSION XM_013436821.1 DBLINK BioProject: PRJNA279932 BioSample: SAMN02953824 KEYWORDS RefSeq. SOURCE Necator americanus ORGANISM Necator americanus Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Strongylida; Ancylostomatoidea; Ancylostomatidae; Bunostominae; Necator. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_013550919)....
XM_013436821.1 -
Necator americanus -
NCBI
misc_feature 250..2931 /locus_tag="CRE_25241" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 316..750 /locus_tag="CRE_25241" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 841..963 /locus_tag="CRE_25241" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1174..1506 /locus_tag="CRE_25241" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003113068.1 -
Caenorhabditis remanei -
NCBI
misc_feature 489..2918 /gene="AGO3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 585..1025 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 1056..1181 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1206..1538 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has...
NM_001287791.1 -
Solanum lycopersicum (Lycopersicon esculentum) -
NCBI
misc_feature 69..410 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(204..206,249..251,291..293,303..305,357..359, 378..380,384..386) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 543..1820 /gene="AGO3" /note="Piwi_ago-...
XM_023633508.1 -
Equus caballus (horse) -
NCBI
misc_feature 159..413 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 444..596 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 597..959 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_023758506.1 -
Myotis lucifugus (little brown bat) -
NCBI
misc_feature 140..481 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(275..277,320..322,362..364,374..376,428..430, 449..451,455..457) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 614..1891 /gene="AGO3" /note="Piwi_ago-...
XM_023633506.1 -
Equus caballus (horse) -
NCBI
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="Piwi_ago-...
XM_023633498.1 -
Equus caballus (horse) -
NCBI
misc_feature 113..502 /gene="Ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 533..685 /gene="Ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 686..1048 /gene="Ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_026782069.1 -
Microtus ochrogaster (prairie vole) -
NCBI
misc_feature 108..449 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(243..245,288..290,330..332,342..344,396..398, 417..419,423..425) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 582..1859 /gene="AGO3" /note="Piwi_ago-...
XM_027059683.1 -
Acinonyx jubatus (cheetah) -
NCBI
misc_feature 241..465 /gene="LOC113488159" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 493..645 /gene="LOC113488159" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 646..1008 /gene="LOC113488159" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_026863202.1 -
Athene cunicularia (burrowing owl) -
NCBI
misc_feature 190..531 /gene="Ago3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(325..327,370..372,412..414,424..426,478..480, 499..501,505..507) /gene="Ago3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 664..1941 /gene="Ago3" /note="Piwi_ago-...
XM_016974870.2 -
Cricetulus griseus (Chinese hamster) -
NCBI
misc_feature 195..536 /gene="Ago3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(330..332,375..377,417..419,429..431,483..485, 504..506,510..512) /gene="Ago3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 669..1946 /gene="Ago3" /note="Piwi_ago-...
XM_016974869.2 -
Cricetulus griseus (Chinese hamster) -
NCBI
misc_feature 109..450 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(244..246,289..291,331..333,343..345,397..399, 418..420,424..426) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 583..1860 /gene="AGO3" /note="Piwi_ago-...
XM_026516686.1 -
Ursus arctos horribilis -
NCBI
misc_feature 191..532 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(326..328,371..373,413..415,425..427,479..481, 500..502,506..508) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 665..1942 /gene="AGO3" /note="Piwi_ago-...
XM_026516685.1 -
Ursus arctos horribilis -
NCBI
misc_feature 1474..1815 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1609..1611,1654..1656,1696..1698,1708..1710, 1762..1764,1783..1785,1789..1791) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1948..3225 /gene="...
XM_026516684.1 -
Ursus arctos horribilis -
NCBI
misc_feature 189..530 /gene="LOC101573127" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(324..326,369..371,411..413,423..425,477..479, 498..500,504..506) /gene="LOC101573127" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 663..1940 /gene="...
XM_023701039.1 -
Octodon degus (degu) -
NCBI
misc_feature 779..1120 /gene="LOC101573127" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(914..916,959..961,1001..1003,1013..1015,1067..1069, 1088..1090,1094..1096) /gene="LOC101573127" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1253..2530 /...
XM_023701038.1 -
Octodon degus (degu) -
NCBI
misc_feature 498..860 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(654..656,699..701,741..743,753..755,807..809, 828..830,834..836) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 993..2270 /gene="AGO3" /note="Piwi_ago-...
XM_027059682.1 -
Acinonyx jubatus (cheetah) -
NCBI
misc_feature 301..693 /gene="LOC101571277" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 721..873 /gene="LOC101571277" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 874..1236 /gene="LOC101571277" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_023701070.1 -
Octodon degus (degu) -
NCBI
misc_feature 62..403 /gene="LOC102996689" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(197..199,242..244,284..286,296..298,350..352, 371..373,377..379) /gene="LOC102996689" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 536..1813 /gene="...
XM_024125565.1 -
Physeter catodon (sperm whale) -
NCBI
misc_feature 105..446 /gene="LOC102996689" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(240..242,285..287,327..329,339..341,393..395, 414..416,420..422) /gene="LOC102996689" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 579..1856 /gene="...
XM_024125564.1 -
Physeter catodon (sperm whale) -
NCBI
misc_feature 269..661 /gene="LOC101993325" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 689..841 /gene="LOC101993325" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 842..1204 /gene="LOC101993325" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_026782012.1 -
Microtus ochrogaster (prairie vole) -
NCBI
misc_feature 207..359 /gene="LOC101086581" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 360..722 /gene="LOC101086581" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(516..518,561..563,603..605,615..617,669..671, 690..692,696..698) /gene="LOC101086581" /note...
XM_019836651.1 -
Felis catus (domestic cat) -
NCBI
misc_feature 328..588 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 616..768 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 769..1131 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_026716020.1 -
Pseudonaja textilis -
NCBI
misc_feature 105..446 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(240..242,285..287,327..329,339..341,393..395, 414..416,420..422) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 579..1856 /gene="AGO3" /note="Piwi_ago-...
XM_023529366.1 -
Pteropus vampyrus (large flying fox) -
NCBI
misc_feature 179..520 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(314..316,359..361,401..403,413..415,467..469, 488..490,494..496) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 653..1930 /gene="AGO3" /note="Piwi_ago-...
XM_023529365.1 -
Pteropus vampyrus (large flying fox) -
NCBI
misc_feature 254..469 /gene="LOC111346866" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 497..649 /gene="LOC111346866" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature <731..1012 /gene="LOC111346866" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_022954129.1 -
Stylophora pistillata -
NCBI
Data Export:
Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.
Debug Info:
Redirect URI : http://ggrna.dbcls.jp/en/Argonaute+%22PAZ+domain%22
lang : en |
div : |
spe : |
query_string : Argonaute "PAZ domain" |
format : html |
download :
0.000 | 0.000 | search_start;
0.076 | 0.076 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.385 | 0.309 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.486 | 0.101 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.494 | 0.009 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]