GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-12-12 08:45:15, GGRNA : RefSeq release 91 (Nov, 2018)



Matches are highlighted with green background. Overlapping matches are dark colored.

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated...
XM_024651321.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not...
XM_024650915.1 - Strongyloides ratti - NCBI
Strongyloides ratti Protein argonaute-2 (SRAE_0000056900), partial mRNA. (846 bp)
XM_024646477.1 - Strongyloides ratti - NCBI
Aspergillus fischeri NRRL 181 PAZ domain protein partial mRNA. (1410 bp)
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_001263935.1 - Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16204) partial mRNA. (2352 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2352 /gene="AGO16204" /locus_tag="LACBIDRAFT_315429" /db_xref="GeneID:6074035" CDS 1..2352 /gene="AGO16204" /locus_tag="LACBIDRAFT_315429" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001878380.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6074035" /translation="...
XM_001878345.1 - Laccaria bicolor S238N-H82 - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein partial mRNA. (2898 bp)
Qualifiers source 1..2898 /organism="Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2898 /locus_tag="LACBIDRAFT_295925" /db_xref="GeneID:6085310" CDS 1..2898 /locus_tag="LACBIDRAFT_295925" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001889672.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6085310" /translation="...
XM_001889637.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Tetranychus urticae protein argonaute-2-like (LOC107367184), partial mRNA. (1201 bp)
misc_feature 226..687 /gene="LOC107367184" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 868..1200 /gene="LOC107367184" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1021..1023,1066..1068,1102..1104,1114..1116, 1168..1170,1186..1188) /gene="...
XM_015934897.1 - Tetranychus urticae (two-spotted spider mite) - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16202) partial mRNA. (2715 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2715 /gene="AGO16202" /locus_tag="LACBIDRAFT_311854" /db_xref="GeneID:6072122" CDS 1..2715 /gene="AGO16202" /locus_tag="LACBIDRAFT_311854" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001876710.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6072122" /translation="...
XM_001876675.1 - Laccaria bicolor S238N-H82 - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16205) partial mRNA. (2766 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2766 /gene="AGO16205" /locus_tag="LACBIDRAFT_311445" /db_xref="GeneID:6072513" CDS 1..2766 /gene="AGO16205" /locus_tag="LACBIDRAFT_311445" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001876972.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6072513" /translation="...
XM_001876937.1 - Laccaria bicolor S238N-H82 - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16201) partial mRNA. (2886 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2886 /gene="AGO16201" /locus_tag="LACBIDRAFT_317035" /db_xref="GeneID:6074423" CDS 1..2886 /gene="AGO16201" /locus_tag="LACBIDRAFT_317035" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001878739.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6074423" /translation="...
XM_001878704.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Diaphorina citri protein argonaute-4-like (LOC103524044), partial mRNA. (231 bp)
alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GeneID:103524044" /translation="MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC" misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the...
XM_008489050.1 - Diaphorina citri (Asian citrus psyllid) - NCBI
PREDICTED: Canis lupus dingo argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (14606 bp)
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="Piwi_ago-...
XM_025419944.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (14644 bp)
misc_feature 177..518 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(312..314,357..359,399..401,411..413,465..467, 486..488,492..494) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 651..1928 /gene="AGO3" /note="Piwi_ago-...
XM_025419943.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Pan paniscus argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (3100 bp)
misc_feature 503..844 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="AGO3" /note="Piwi_ago-...
XM_024928002.1 - Pan paniscus (pygmy chimpanzee) - NCBI
PREDICTED: Pan paniscus argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (2848 bp)
misc_feature 251..592 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(386..388,431..433,473..475,485..487,539..541, 560..562,566..568) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 725..2002 /gene="AGO3" /note="Piwi_ago-...
XM_024928006.1 - Pan paniscus (pygmy chimpanzee) - NCBI
PREDICTED: Canis lupus dingo argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (14654 bp)
misc_feature 166..528 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(322..324,367..369,409..411,421..423,475..477, 496..498,502..504) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 661..1938 /gene="AGO3" /note="Piwi_ago-...
XM_025419942.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Bubalus bubalis argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (5161 bp)
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="Piwi_ago-...
XM_025289099.1 - Bubalus bubalis (water buffalo) - NCBI
Xenopus laevis argonaute 4, RISC catalytic component L homeolog (ago4.L), mRNA. (4129 bp)
ago4; argonaute-4; Argonaute4; eif2c4" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 141..554 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 588..737 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 738..1100 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="PAZ domain, argonaute_like...
Synonym: ago4; argonaute-4; Argonaute4; eif2c4
NM_001096105.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Bubalus bubalis argonaute 2, RISC catalytic component (AGO2), transcript variant X5, mRNA. (13824 bp)
misc_feature 204..356 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 357..719 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(513..515,558..560,600..602,612..614,666..668, 687..689,693..695) /gene="AGO2" /note="nucleic acid-binding...
XM_025264831.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Alligator sinensis protein argonaute-1 (LOC102373826), transcript variant X7, mRNA. (2271 bp)
misc_feature 233..457 /gene="LOC102373826" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 485..637 /gene="LOC102373826" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 638..1000 /gene="LOC102373826" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025208056.1 - Alligator sinensis (Chinese alligator) - NCBI
PREDICTED: Bubalus bubalis argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (5426 bp)
misc_feature 230..382 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 383..745 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(539..541,584..586,626..628,638..640,692..694, 713..715,719..721) /gene="AGO3" /note="nucleic acid-binding...
XM_025289098.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Ziziphus jujuba protein argonaute 10 (LOC107423077), mRNA. (2843 bp)
misc_feature 348..692 /gene="LOC107423077" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(495..497,540..542,573..575,585..587,639..641, 660..662,666..668) /gene="LOC107423077" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 825..2177 /gene="...
XM_025075996.1 - Ziziphus jujuba (common jujube) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X9, mRNA. (15052 bp)
misc_feature 114..455 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(249..251,294..296,336..338,348..350,402..404, 423..425,429..431) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 588..1865 /gene="AGO3" /note="Piwi_ago-...
XM_025041517.1 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (15118 bp)
misc_feature 180..521 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(315..317,360..362,402..404,414..416,468..470, 489..491,495..497) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 654..1931 /gene="AGO3" /note="Piwi_ago-...
XM_025041516.1 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Bubalus bubalis argonaute 2, RISC catalytic component (AGO2), transcript variant X4, mRNA. (2888 bp)
misc_feature 726..950 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 978..1130 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1131..1493 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025264830.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (3735 bp)
misc_feature 1138..1479 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1273..1275,1318..1320,1360..1362,1372..1374, 1426..1428,1447..1449,1453..1455) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1612..2889 /gene="...
XM_024357879.1 - Pan troglodytes (chimpanzee) - NCBI
Strongyloides ratti Protein argonaute-4 (SRAE_0000025800), partial mRNA. (2871 bp)
misc_feature 538..756 /locus_tag="SRAE_25800" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 784..963 /locus_tag="SRAE_25800" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 973..1332 /locus_tag="SRAE_25800" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_024646124.1 - Strongyloides ratti - NCBI
PREDICTED: Canis lupus dingo protein argonaute-1 (LOC112642408), transcript variant X5, mRNA. (8193 bp)
misc_feature 222..374 /gene="LOC112642408" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 375..737 /gene="LOC112642408" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(531..533,576..578,618..620,630..632,684..686, 705..707,711..713) /gene="LOC112642408" /note...
XM_025419949.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Homo sapiens argonaute 4, RISC catalytic component (AGO4), transcript variant X8, mRNA. (7168 bp)
misc_feature <1419..1697 /gene="AGO4" /gene_synonym="EIF2C4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1491..1493,1536..1538,1578..1580,1590..1592, 1644..1646,1665..1667,1671..1673) /gene="AGO4" /gene_synonym="EIF2C4" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="...
Synonym: EIF2C4
XM_024453795.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X9, mRNA. (2842 bp)
misc_feature <360..578 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(372..374,417..419,459..461,471..473,525..527, 546..548,552..554) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000528.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Alligator sinensis protein argonaute-1 (LOC102373826), transcript variant X5, mRNA. (2406 bp)
misc_feature 233..457 /gene="LOC102373826" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 485..637 /gene="LOC102373826" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 638..1000 /gene="LOC102373826" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025208054.1 - Alligator sinensis (Chinese alligator) - NCBI
PREDICTED: Alligator sinensis protein argonaute-1 (LOC102373826), transcript variant X4, mRNA. (2424 bp)
misc_feature 233..457 /gene="LOC102373826" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 485..637 /gene="LOC102373826" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 638..1000 /gene="LOC102373826" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025208053.1 - Alligator sinensis (Chinese alligator) - NCBI
Strongyloides ratti Protein argonaute-4 (SRAE_X000201400), partial mRNA. (2901 bp)
misc_feature 385..777 /locus_tag="SRAE_X000201400" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 805..996 /locus_tag="SRAE_X000201400" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1000..1362 /locus_tag="SRAE_X000201400" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_...
XM_024643007.1 - Strongyloides ratti - NCBI
PREDICTED: Bubalus bubalis protein argonaute-1 (LOC102406024), transcript variant X4, mRNA. (8147 bp)
misc_feature 230..382 /gene="LOC102406024" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 383..745 /gene="LOC102406024" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(539..541,584..586,626..628,638..640,692..694, 713..715,719..721) /gene="LOC102406024" /note...
XM_025289092.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Macaca nemestrina argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (3220 bp)
misc_feature 503..844 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="AGO3" /note="Piwi_ago-...
XM_011763420.1 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X10, mRNA. (3892 bp)
misc_feature <1410..1628 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1422..1424,1467..1469,1509..1511,1521..1523, 1575..1577,1596..1598,1602..1604) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="...
Synonym: EIF2C3
XM_005270576.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Macaca nemestrina argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (3047 bp)
misc_feature 330..671 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(465..467,510..512,552..554,564..566,618..620, 639..641,645..647) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 804..2081 /gene="AGO3" /note="Piwi_ago-...
XM_011763423.1 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Macaca nemestrina argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (3095 bp)
misc_feature 378..719 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(513..515,558..560,600..602,612..614,666..668, 687..689,693..695) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 852..2129 /gene="AGO3" /note="Piwi_ago-...
XM_011763422.1 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Desmodus rotundus argonaute 4, RISC catalytic component (AGO4), transcript variant X4, mRNA. (4735 bp)
misc_feature 1884..2273 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 2304..2456 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 2457..2819 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_024554566.1 - Desmodus rotundus (common vampire bat) - NCBI
PREDICTED: Canis lupus dingo argonaute 2, RISC catalytic component (AGO2), transcript variant X2, mRNA. (14332 bp)
misc_feature 79..303 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 331..483 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 484..846 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_...
XM_025450841.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Theropithecus gelada argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (2885 bp)
misc_feature 289..630 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(424..426,469..471,511..513,523..525,577..579, 598..600,604..606) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 763..2040 /gene="AGO3" /note="Piwi_ago-...
XM_025383335.1 - Theropithecus gelada (gelada) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (2716 bp)
misc_feature 119..460 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(254..256,299..301,341..343,353..355,407..409, 428..430,434..436) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 593..1870 /gene="AGO3" /note="Piwi_ago-...
XM_016959152.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (15115 bp)
misc_feature 177..518 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(312..314,357..359,399..401,411..413,465..467, 486..488,492..494) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 651..1928 /gene="AGO3" /note="Piwi_ago-...
XM_015598969.2 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Theropithecus gelada argonaute 3, RISC catalytic component (AGO3), transcript variant X2, mRNA. (3379 bp)
misc_feature 783..1124 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(918..920,963..965,1005..1007,1017..1019,1071..1073, 1092..1094,1098..1100) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1257..2534 /gene="AGO3" /note...
XM_025383331.1 - Theropithecus gelada (gelada) - NCBI
PREDICTED: Macaca nemestrina argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (3897 bp)
misc_feature 1180..1521 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1315..1317,1360..1362,1402..1404,1414..1416, 1468..1470,1489..1491,1495..1497) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1654..2931 /gene="...
XM_011763421.1 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (2714 bp)
misc_feature 109..450 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(244..246,289..291,331..333,343..345,397..399, 418..420,424..426) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000526.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (2893 bp)
misc_feature 288..629 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(423..425,468..470,510..512,522..524,576..578, 597..599,603..605) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000527.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (2755 bp)
misc_feature 150..491 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(285..287,330..332,372..374,384..386,438..440, 459..461,465..467) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000525.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (2750 bp)
misc_feature 145..486 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(280..282,325..327,367..369,379..381,433..435, 454..456,460..462) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_011540882.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.080 | 0.080 | count_done;*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.093 | 0.012 | count_done;*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.252 | 0.160 | search_done;*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.261 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]