GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-05-24 11:17:24, GGRNA : RefSeq release 87 (Mar, 2018)



Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Diaphorina citri protein argonaute-4-like (LOC103524044), partial mRNA. (231 bp)
alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GeneID:103524044" /translation="MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC" misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the...
XM_008489050.1 - Diaphorina citri (Asian citrus psyllid) - NCBI
PREDICTED: Rattus norvegicus protein argonaute-4-like (LOC102554576), mRNA. (968 bp)
LOC102554576" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_006227744.1" /db_xref="GeneID:102554576" /db_xref="RGD:7706370" /translation="MEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGHLSEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNGQDDQPVIKRMWITCKTIWEPYMMV" misc_feature 570..719 /gene="LOC102554576" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 720..>902 /gene="LOC102554576" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-...
XM_006227682.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Aspergillus fischeri NRRL 181 PAZ domain protein partial mRNA. (1410 bp)
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_001263935.1 - Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) - NCBI
PREDICTED: Xenopus tropicalis argonaute 2, RISC catalytic component (ago2), transcript variant X1, mRNA. (4811 bp)
feature 409..2913 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 418..837 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 868..1017 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1018..1380 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the...
Synonym: Argonaute2; eif2c2
XM_012964517.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (3100 bp)
misc_feature 503..844 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="AGO3" /note="Piwi_ago-...
XM_016959144.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (3145 bp)
misc_feature 548..889 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(683..685,728..730,770..772,782..784,836..838, 857..859,863..865) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1022..2299 /gene="AGO3" /note="Piwi_ago-...
XM_016959152.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Capra hircus argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (15262 bp)
misc_feature 247..588 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(382..384,427..429,469..471,481..483,535..537, 556..558,562..564) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 721..1998 /gene="AGO3" /note="Piwi_ago-...
XM_018041542.1 - Capra hircus (goat) - NCBI
PREDICTED: Manis javanica argonaute 1, RISC catalytic component (AGO1), transcript variant X5, mRNA. (6849 bp)
misc_feature 174..326 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 327..689 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(483..485,528..530,570..572,582..584,636..638, 657..659,663..665) /gene="AGO1" /note="nucleic acid-binding...
XM_017660999.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X5, mRNA. (3136 bp)
misc_feature 190..531 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(325..327,370..372,412..414,424..426,478..480, 499..501,505..507) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 664..1941 /gene="...
XM_016974870.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X3, mRNA. (3141 bp)
misc_feature 195..536 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(330..332,375..377,417..419,429..431,483..485, 504..506,510..512) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 669..1946 /gene="...
XM_016974869.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Mus musculus argonaute RISC catalytic subunit 4 (Ago4), transcript variant X4, mRNA. (3265 bp)
misc_feature <508..636 /gene="Ago4" /gene_synonym="5730550L01Rik; AI481660; Eif2c4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature 775..2082 /gene="Ago4" /gene_synonym="5730550L01Rik; AI481660; Eif2c4" /note="Piwi_ago-like: PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-...
Synonym: 5730550L01Rik; AI481660; Eif2c4
XM_006503483.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X5, mRNA. (3010 bp)
misc_feature 190..531 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(325..327,370..372,412..414,424..426,478..480, 499..501,505..507) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 664..1941 /gene="...
XM_016967521.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X3, mRNA. (3015 bp)
misc_feature 195..536 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(330..332,375..377,417..419,429..431,483..485, 504..506,510..512) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 669..1946 /gene="...
XM_016967520.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X4, mRNA. (4508 bp)
misc_feature 1562..1903 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1697..1699,1742..1744,1784..1786,1796..1798, 1850..1852,1871..1873,1877..1879) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007641614.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X2, mRNA. (4513 bp)
misc_feature 1567..1908 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1702..1704,1747..1749,1789..1791,1801..1803, 1855..1857,1876..1878,1882..1884) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007641613.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Rhinopithecus bieti protein argonaute-3 (LOC108537261), transcript variant X3, mRNA. (2697 bp)
misc_feature 98..439 /gene="LOC108537261" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(233..235,278..280,320..322,332..334,386..388, 407..409,413..415) /gene="LOC108537261" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 572..1849 /gene="...
XM_017884483.1 - Rhinopithecus bieti (black snub-nosed monkey) - NCBI
PREDICTED: Rhinopithecus bieti protein argonaute-3 (LOC108537261), transcript variant X2, mRNA. (3102 bp)
misc_feature 503..844 /gene="LOC108537261" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="LOC108537261" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="...
XM_017884481.1 - Rhinopithecus bieti (black snub-nosed monkey) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X4, mRNA. (4368 bp)
misc_feature 1548..1889 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1683..1685,1728..1730,1770..1772,1782..1784, 1836..1838,1857..1859,1863..1865) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007618594.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X2, mRNA. (4373 bp)
misc_feature 1553..1894 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1688..1690,1733..1735,1775..1777,1787..1789, 1841..1843,1862..1864,1868..1870) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007618593.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X7, mRNA. (2489 bp)
misc_feature 109..450 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(244..246,289..291,331..333,343..345,397..399, 418..420,424..426) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 583..1860 /gene="...
XM_017501083.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X3, mRNA. (2883 bp)
misc_feature 503..844 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="...
XM_017501079.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X5, mRNA. (2916 bp)
misc_feature 536..877 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(671..673,716..718,758..760,770..772,824..826, 845..847,851..853) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1010..2287 /gene="...
XM_017501081.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X4, mRNA. (2964 bp)
misc_feature 584..925 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(719..721,764..766,806..808,818..820,872..874, 893..895,899..901) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1058..2335 /gene="...
XM_017501080.1 - Cebus capucinus imitator - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X10, mRNA. (12271 bp)
misc_feature 185..334 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 335..697 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(491..493,536..538,578..580,590..592,644..646, 665..667,671..673) /gene="AGO1" /note="nucleic acid-binding...
XM_009453704.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X6, mRNA. (3030 bp)
misc_feature 650..991 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(785..787,830..832,872..874,884..886,938..940, 959..961,965..967) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1124..2401 /gene="...
XM_017501082.1 - Cebus capucinus imitator - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X3, mRNA. (4706 bp)
misc_feature 274..498 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 526..678 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 679..1041 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_017649847.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X2, mRNA. (4703 bp)
misc_feature 271..495 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 523..675 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 676..1038 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_017649846.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X4, mRNA. (4744 bp)
misc_feature 312..536 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 564..716 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 717..1079 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_017649848.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X1, mRNA. (4757 bp)
misc_feature 325..549 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 577..729 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 730..1092 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_017649845.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X9, mRNA. (12367 bp)
misc_feature 281..430 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 431..793 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(587..589,632..634,674..676,686..688,740..742, 761..763,767..769) /gene="AGO1" /note="nucleic acid-binding...
XM_009453699.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (3187 bp)
misc_feature 104..388 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 416..568 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 569..931 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_016959129.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Poecilia reticulata protein argonaute-3-like (LOC103473053), mRNA. (2801 bp)
misc_feature 343..2517 /gene="LOC103473053" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 343..786 /gene="LOC103473053" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 817..966 /gene="LOC103473053" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 967..1329 /gene="LOC103473053" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_008422983.2 - Poecilia reticulata (guppy) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (3219 bp)
misc_feature 136..420 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 448..600 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 601..963 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_016959137.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-4 (LOC100762217), mRNA. (3772 bp)
misc_feature 209..463 /gene="LOC100762217" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 494..646 /gene="LOC100762217" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 647..1009 /gene="LOC100762217" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_016974867.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Pan troglodytes argonaute 4, RISC catalytic component (AGO4), transcript variant X5, mRNA. (7078 bp)
misc_feature 422..676 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 707..859 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 860..1222 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_016959078.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Callithrix jacchus argonaute 2, RISC catalytic component (AGO2), mRNA. (3542 bp)
misc_feature 376..600 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 628..780 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 781..1143 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_017965571.1 - Callithrix jacchus (white-tufted-ear marmoset) - NCBI
PREDICTED: Capra hircus argonaute 3, RISC catalytic component (AGO3), transcript variant X2, mRNA. (15697 bp)
misc_feature 196..480 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 508..660 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 661..1023 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_018041526.1 - Capra hircus (goat) - NCBI
PREDICTED: Manis javanica argonaute 1, RISC catalytic component (AGO1), transcript variant X4, mRNA. (7405 bp)
misc_feature 310..702 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 730..882 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 883..1245 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_017660998.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Mus musculus argonaute RISC catalytic subunit 1 (Ago1), transcript variant X2, mRNA. (6921 bp)
misc_feature 367..519 /gene="Ago1" /gene_synonym="Eif2c1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 520..882 /gene="Ago1" /gene_synonym="Eif2c1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order...
Synonym: Eif2c1
XM_011240521.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Manis javanica argonaute 1, RISC catalytic component (AGO1), transcript variant X3, mRNA. (7414 bp)
misc_feature 310..702 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 730..882 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 883..1245 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_017660997.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Cricetulus griseus argonaute 2, RISC catalytic component (Ago2), mRNA. (3443 bp)
misc_feature 140..2575 /gene="Ago2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 140..499 /gene="Ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 530..679 /gene="Ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 680..1042 /gene="Ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_007651571.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Capra hircus argonaute 2, RISC catalytic component (AGO2), mRNA. (14235 bp)
misc_feature 383..607 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 635..787 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 788..1150 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_018058614.1 - Capra hircus (goat) - NCBI
PREDICTED: Rattus norvegicus argonaute 3, RISC catalytic component (Ago3), transcript variant X2, mRNA. (10742 bp)
misc_feature 81..422 /gene="Ago3" /gene_synonym="Eif2c3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(216..218,261..263,303..305,315..317,369..371, 390..392,396..398) /gene="Ago3" /gene_synonym="Eif2c3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: Eif2c3
XM_017593400.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Pan troglodytes argonaute 2, RISC catalytic component (AGO2), transcript variant X3, mRNA. (15409 bp)
misc_feature 1215..1439 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 1467..1619 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1620..1982 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_016959913.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-1 (LOC100768807), transcript variant X1, mRNA. (3400 bp)
misc_feature 262..486 /gene="LOC100768807" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 514..666 /gene="LOC100768807" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 667..1029 /gene="LOC100768807" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_016974868.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus argonaute 2, RISC catalytic component (Ago2), mRNA. (3442 bp)
misc_feature 139..2574 /gene="Ago2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 139..498 /gene="Ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 529..678 /gene="Ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 679..1041 /gene="Ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_007609494.2 - Cricetulus griseus (Chinese hamster) - NCBI
Brugia malayi PAZ domain containing protein partial mRNA. (1245 bp)
misc_feature 832..1170 /locus_tag="Bm1_18705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(979..981,1024..1026,1051..1053,1063..1065, 1117..1119,1138..1140,1144..1146) /locus_tag="Bm1_18705" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN // REFERENCE...
XM_001895163.1 - Brugia malayi - NCBI
PREDICTED: Rhinopithecus bieti argonaute 2, RISC catalytic component (AGO2), mRNA. (14476 bp)
misc_feature 277..501 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 529..681 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 682..1044 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_017895119.1 - Rhinopithecus bieti (black snub-nosed monkey) - NCBI
PREDICTED: Anolis carolinensis protein argonaute-1 (LOC100556413), transcript variant X1, mRNA. (4742 bp)
misc_feature 140..364 /gene="LOC100556413" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 392..544 /gene="LOC100556413" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 545..907 /gene="LOC100556413" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_008120670.2 - Anolis carolinensis (green anole) - NCBI
PREDICTED: Anolis carolinensis protein argonaute-1 (LOC100556413), transcript variant X2, mRNA. (4871 bp)
misc_feature 269..493 /gene="LOC100556413" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 521..673 /gene="LOC100556413" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 674..1036 /gene="LOC100556413" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_008120671.2 - Anolis carolinensis (green anole) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.078 | 0.078 | count_done;*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.089 | 0.011 | count_done;*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.253 | 0.164 | search_done;*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.262 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]