GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-01-21 15:16:18, GGRNA : RefSeq release 79 (Nov, 2016)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Neosartorya fischeri NRRL 181 PAZ domain protein (NFIA_024180) partial mRNA. (1410 bp)
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_001263935.1 - Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) - NCBI
Arabidopsis lyrata subsp. lyrata PAZ domain-containing protein, mRNA. (2547 bp)
misc_feature 4..2544 /locus_tag="ARALYDRAFT_326484" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 49..516 /locus_tag="ARALYDRAFT_326484" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 550..699 /locus_tag="ARALYDRAFT_326484" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 748..1092 /locus_tag="ARALYDRAFT_326484" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:280352" misc_feature order...
XM_002873982.1 - Arabidopsis lyrata subsp. lyrata - NCBI
Arabidopsis lyrata subsp. lyrata PAZ domain-containing protein, mRNA. (2674 bp)
misc_feature 63..2645 /locus_tag="ARALYDRAFT_902361" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 105..608 /locus_tag="ARALYDRAFT_902361" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 642..788 /locus_tag="ARALYDRAFT_902361" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 837..1178 /locus_tag="ARALYDRAFT_902361" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:280352" misc_feature order...
XM_002881208.1 - Arabidopsis lyrata subsp. lyrata - NCBI
Arabidopsis lyrata subsp. lyrata PAZ domain-containing protein, mRNA. (2940 bp)
misc_feature 213..2813 /locus_tag="ARALYDRAFT_489025" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 240..734 /locus_tag="ARALYDRAFT_489025" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 768..917 /locus_tag="ARALYDRAFT_489025" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 978..1307 /locus_tag="ARALYDRAFT_489025" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:280352" misc_feature order...
XM_002871925.1 - Arabidopsis lyrata subsp. lyrata - NCBI
Arabidopsis thaliana PAZ domain-containing protein / piwi domain-containing protein mRNA. (2628 bp)
locus_tag="AT5G21030" /gene_synonym="T10F18.3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 79..549 /locus_tag="AT5G21030" /gene_synonym="T10F18.3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 583..732 /locus_tag="AT5G21030" /gene_synonym="T10F18.3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 781..1125 /locus_tag="AT5G21030" /gene_synonym="T10F18.3" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:280352" misc_feature order...
Synonym: T10F18.3
NM_122111.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Brugia malayi PAZ domain containing protein partial mRNA. (1245 bp)
misc_feature 832..1170 /locus_tag="Bm1_18705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(979..981,1024..1026,1051..1053,1063..1065, 1117..1119,1138..1140,1144..1146) /locus_tag="Bm1_18705" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN // REFERENCE...
XM_001895163.1 - Brugia malayi - NCBI
PREDICTED: Rattus norvegicus protein argonaute-4-like (LOC102554576), mRNA. (968 bp)
codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_006227744.1" /db_xref="GI:564324702" /db_xref="GeneID:102554576" /db_xref="RGD:7706370" /translation="MEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGHLSEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNGQDDQPVIKRMWITCKTIWEPYMMV" misc_feature 570..719 /gene="LOC102554576" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 720..>902 /gene="LOC102554576" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of...
XM_006227682.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Calidris pugnax protein argonaute-1 (LOC106890550), mRNA. (4616 bp)
CDD:294420" misc_feature order(1552..1554,1564..1566,1600..1611,1618..1620, 1642..1644,1651..1653,1663..1665,1675..1677) /gene="LOC106890550" /note="5' RNA guide strand anchoring site; other site" /db_xref="CDD:239208" misc_feature <1759..1998 /gene="LOC106890550" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature...
XM_014946455.1 - Calidris pugnax (ruff) - NCBI
Xenopus laevis argonaute 4, RISC catalytic component L homeolog (ago4.L), mRNA. (4129 bp)
ago4; argonaute-4; Argonaute4; eif2c4" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 141..554 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 588..737 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 738..1100 /gene="ago4.L" /gene_synonym="ago4; argonaute-4; Argonaute4; eif2c4" /note="PAZ domain, argonaute_like...
Synonym: ago4; argonaute-4; Argonaute4; eif2c4
NM_001096105.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Diaphorina citri protein argonaute-4-like (LOC103524044), partial mRNA. (231 bp)
including 7 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GI:662225713" /db_xref="GeneID:103524044" /translation="MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC" misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named...
XM_008489050.1 - Diaphorina citri (Asian citrus psyllid) - NCBI
Candida albicans SC5314 argonaute-like protein (CaO19_2903) partial mRNA. (1977 bp)
gene 1..1977 /gene="AGO1" /locus_tag="CaO19.2903" /db_xref="GeneID:3642828" CDS 1..1977 /gene="AGO1" /locus_tag="CaO19.2903" /note="similar to C terminal region of several plant Argonaute-like proteins and to S. pombe ago1 (SPCC736.11); potential role in post-transcriptional gene silencing, RNAi; Piwi and PAZ domains; allele of CaO19.10421" /codon_start=1 /transl_table=12 /product="argonaute-like protein fragment" /protein_id="XP_715558.1" /db_xref="GI:68481033" /db_xref="GeneID:3642828" /translation="...
XM_710465.1 - Candida albicans SC5314 - NCBI
Necator americanus PAZ domain protein partial mRNA. (2136 bp)
LOCUS XM_013436821 2136 bp mRNA linear INV 12-AUG-2015 DEFINITION Necator americanus PAZ domain protein partial mRNA. ACCESSION XM_013436821 VERSION XM_013436821.1 GI:915236412 DBLINK BioProject: PRJNA279932 BioSample: SAMN02953824 KEYWORDS RefSeq. SOURCE Necator americanus ORGANISM Necator americanus Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Strongylida; Ancylostomatoidea; Ancylostomatidae; Bunostominae; Necator. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence...
XM_013436821.1 - Necator americanus - NCBI
Candida albicans SC5314 argonaute-like protein fragment (AGO1) mRNA, complete cds. (1977 bp)
gene 1..1977 /gene="AGO1" /locus_tag="CaO19.10421" /db_xref="GeneID:3642764" CDS 1..1977 /gene="AGO1" /locus_tag="CaO19.10421" /note="similar to C terminal region of several plant Argonaute-like proteins and to S. pombe ago1 (SPCC736.11); potential role in post-transcriptional gene silencing, RNAi; Piwi and PAZ domains; allele of CaO19.2903" /codon_start=1 /transl_table=12 /product="argonaute-like protein fragment" /protein_id="XP_715614.1" /db_xref="GI:68480922" /db_xref="GeneID:3642764" /translation="...
XM_710521.1 - Candida albicans SC5314 - NCBI
PREDICTED: Apteryx australis mantelli protein argonaute-1-like (LOC106490864), mRNA. (6336 bp)
misc_feature <43..186 /gene="LOC106490864" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature 352..714 /gene="LOC106490864" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ...
XM_013950384.1 - Apteryx australis mantelli - NCBI
PREDICTED: Xenopus tropicalis argonaute 2, RISC catalytic component (ago2), transcript variant X1, mRNA. (4811 bp)
feature 409..2913 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 418..837 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 868..1017 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1018..1380 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the...
Synonym: Argonaute2; eif2c2
XM_012964517.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
PREDICTED: Danio rerio argonaute RISC catalytic component 3b (ago3b), transcript variant X2, mRNA. (1972 bp)
misc_feature 583..1026 /gene="ago3b" /gene_synonym="ago3; Argonaute3; eif2c3; eif2c3b; sb:eu332; si:dkey-3n22.3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 1057..1206 /gene="ago3b" /gene_synonym="ago3; Argonaute3; eif2c3; eif2c3b; sb:eu332; si:dkey-3n22.3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1207..1569 /gene="ago3b" /gene_synonym="ago3; Argonaute3; eif2c3; eif2c3b; sb:eu332; si:dkey-3n22.3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
Synonym: ago3; Argonaute3; eif2c3; eif2c3b; sb:eu332; si:dkey-3n22.3
XM_009294054.2 - Danio rerio (zebrafish) - NCBI - UCSC
Oryctolagus cuniculus argonaute RISC catalytic component 2 (AGO2), mRNA. (3599 bp)
misc_feature 82..2517 /gene="AGO2" /gene_synonym="EIF2C2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 82..441 /gene="AGO2" /gene_synonym="EIF2C2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 472..621 /gene="AGO2" /gene_synonym="EIF2C2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 622..984 /gene="AGO2" /gene_synonym="EIF2C2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an...
Synonym: EIF2C2
NM_001082710.1 - Oryctolagus cuniculus (rabbit) - NCBI
Loa loa PAZ domain-containing protein (LOAG_15057) mRNA, partial cds. (583 bp)
db_xref="GeneID:9952543" CDS 1..>583 /locus_tag="LOAG_15057" /codon_start=1 /product="PAZ domain-containing protein" /protein_id="XP_003150598.1" /db_xref="GI:312105859" /db_xref="GeneID:9952543" /translation="MYPNQFGFGERDTPELEEGKYVAVGAAKGVRIVEGPRGFEGGINAALVIDVKKAAFHVDNQCLLEKVECILRRSRVILMRGIDHLSIAILSKALKGLFVRCNYGKNRAFTIGGVSKENARTSKLVSRTGEMSVEKYFEMKYSVKLKYPTLPLIMERCQTKSNFYPMEVLIVCENQRVSKGQQTPSQVQTMIRVW" misc_feature 178..516 /locus_tag="LOAG_15057" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key...
XM_003150550.1 - Loa loa (eye worm) - NCBI
Rattus norvegicus argonaute 4, RISC catalytic component (Ago4), mRNA. (3737 bp)
misc_feature <914..1132 /gene="Ago4" /gene_synonym="Eif2c4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(926..928,971..973,1013..1015,1025..1027,1079..1081, 1100..1102,1106..1108) /gene="Ago4" /gene_synonym="Eif2c4" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD...
Synonym: Eif2c4
NM_001106686.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Manis javanica argonaute 1, RISC catalytic component (AGO1), transcript variant X5, mRNA. (6849 bp)
misc_feature 177..326 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 327..689 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(483..485,528..530,570..572,582..584,636..638, 657..659,663..665) /gene="AGO1" /note="nucleic acid-binding...
XM_017660999.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Cuculus canorus protein argonaute-4 {ECO:0000255|HAMAP-Rule:MF_03033} (LOC104065370), mRNA. (4629 bp)
and heterochromatin-related guide RNAs. The...; Region: Piwi-like; cl00628" /db_xref="CDD:294420" misc_feature <1523..1738 /gene="LOC104065370" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 1772..1921 /gene="LOC104065370" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1922..2284 /gene="LOC104065370" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ...
XM_009567836.1 - Cuculus canorus (common cuckoo) - NCBI
PREDICTED: Tetranychus urticae protein argonaute-2-like (LOC107367184), partial mRNA. (1201 bp)
misc_feature 226..687 /gene="LOC107367184" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 868..1200 /gene="LOC107367184" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1021..1023,1066..1068,1102..1104,1114..1116, 1168..1170,1186..1188) /gene="...
XM_015934897.1 - Tetranychus urticae (two-spotted spider mite) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X3, mRNA. (4706 bp)
misc_feature 139..2574 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 139..498 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 529..678 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 679..1041 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017649847.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X2, mRNA. (4703 bp)
misc_feature 136..2571 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 136..495 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 526..675 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 676..1038 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017649846.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X4, mRNA. (4744 bp)
misc_feature 177..2612 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 177..536 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 567..716 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 717..1079 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017649848.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X1, mRNA. (4757 bp)
misc_feature 190..2625 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 190..549 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 580..729 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 730..1092 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017649845.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Papio anubis protein argonaute-3 (LOC101005189), transcript variant X7, mRNA. (2928 bp)
misc_feature 332..673 /gene="LOC101005189" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(467..469,512..514,554..556,566..568,620..622, 641..643,647..649) /gene="LOC101005189" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 806..2083 /gene="...
XM_009204736.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis protein argonaute-3 (LOC101005189), transcript variant X6, mRNA. (2976 bp)
misc_feature 380..721 /gene="LOC101005189" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(515..517,560..562,602..604,614..616,668..670, 689..691,695..697) /gene="LOC101005189" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 854..2131 /gene="...
XM_009204731.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Brassica napus protein argonaute 1-like (LOC106373411), mRNA. (519 bp)
Proteins" /db_xref="GeneID:106373411" CDS 1..519 /gene="LOC106373411" /codon_start=1 /product="protein argonaute 1-like" /protein_id="XP_013669039.1" /db_xref="GI:923733871" /db_xref="GeneID:106373411" /translation="MGLSLNIDMSSTAFIEALPVTEFVCELLNRDIRSRPLSDADRVKIKKALRGVKVEVTHRGNMRRKYRISGLTAVATRELTFPVDERNTQKSVVEYFYETYGFRIQHTQLPCLQVGNSNRPNYLPMEVCKIVEGQRYSKRLNERQITALLKVTCQRPQEREKDILRVSFVFDF" misc_feature 49..393 /gene="LOC106373411" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_013813585.1 - Brassica napus (rape) - NCBI
PREDICTED: Limulus polyphemus protein argonaute-2-like (LOC106460889), mRNA. (1156 bp)
misc_feature 275..688 /gene="LOC106460889" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 719..868 /gene="LOC106460889" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 869..>1153 /gene="LOC106460889" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_013920645.1 - Limulus polyphemus (Atlantic horseshoe crab) - NCBI
PREDICTED: Manis javanica argonaute 1, RISC catalytic component (AGO1), transcript variant X3, mRNA. (7414 bp)
misc_feature 286..2787 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 286..702 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 733..882 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 883..1245 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017660997.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Capra hircus argonaute 2, RISC catalytic component (AGO2), mRNA. (14235 bp)
misc_feature 182..2683 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 191..607 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 638..787 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 788..1150 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_018058614.1 - Capra hircus (goat) - NCBI
PREDICTED: Rattus norvegicus argonaute 3, RISC catalytic component (Ago3), transcript variant X2, mRNA. (10742 bp)
misc_feature 81..422 /gene="Ago3" /gene_synonym="Eif2c3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(216..218,261..263,303..305,315..317,369..371, 390..392,396..398) /gene="Ago3" /gene_synonym="Eif2c3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: Eif2c3
XM_017593400.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Capra hircus argonaute 1, RISC catalytic component (AGO1), transcript variant X1, mRNA. (8781 bp)
misc_feature 426..2927 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 426..842 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 873..1022 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1023..1385 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has...
XM_018041500.1 - Capra hircus (goat) - NCBI
PREDICTED: Phoenix dactylifera protein argonaute 10 (LOC103698685), partial mRNA. (2512 bp)
misc_feature <4..144 /gene="LOC103698685" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 175..324 /gene="LOC103698685" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 325..666 /gene="LOC103698685" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db...
XM_008780726.2 - Phoenix dactylifera (date palm) - NCBI
PREDICTED: Papio anubis argonaute 4, RISC catalytic component (AGO4), transcript variant X2, mRNA. (6568 bp)
misc_feature <271..534 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 568..717 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 718..1080 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009204706.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis argonaute 4, RISC catalytic component (AGO4), transcript variant X1, mRNA. (6942 bp)
misc_feature <645..908 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 942..1091 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1092..1454 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009204700.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Rattus norvegicus argonaute 3, RISC catalytic component (Ago3), transcript variant X1, mRNA. (12087 bp)
misc_feature 1426..1767 /gene="Ago3" /gene_synonym="Eif2c3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1561..1563,1606..1608,1648..1650,1660..1662, 1714..1716,1735..1737,1741..1743) /gene="Ago3" /gene_synonym="Eif2c3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD...
Synonym: Eif2c3
XM_008764024.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Capra hircus argonaute 1, RISC catalytic component (AGO1), transcript variant X2, mRNA. (8772 bp)
misc_feature 426..2918 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 426..842 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 873..1022 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1023..1385 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has...
XM_005678708.3 - Capra hircus (goat) - NCBI
PREDICTED: Cyprinodon variegatus protein argonaute-3-like (LOC107098936), mRNA. (1607 bp)
misc_feature 324..767 /gene="LOC107098936" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 798..947 /gene="LOC107098936" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 948..1310 /gene="LOC107098936" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_015396831.1 - Cyprinodon variegatus (sheepshead minnow) - NCBI
PREDICTED: Phoenix dactylifera protein argonaute MEL1-like (LOC103698577), mRNA. (3129 bp)
misc_feature 196..2802 /gene="LOC103698577" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 223..660 /gene="LOC103698577" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 691..837 /gene="LOC103698577" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 841..1185 /gene="LOC103698577" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_008780612.2 - Phoenix dactylifera (date palm) - NCBI
PREDICTED: Manacus vitellinus argonaute 2, RISC catalytic component (AGO2), transcript variant X1, mRNA. (3558 bp)
misc_feature 165..2669 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 174..593 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 624..773 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 774..1136 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_018075864.1 - Manacus vitellinus (golden-collared manakin) - NCBI
PREDICTED: Metaseiulus occidentalis protein argonaute-2 (LOC100900200), mRNA. (2714 bp)
misc_feature 171..2528 /gene="LOC100900200" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 192..614 /gene="LOC100900200" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 651..806 /gene="LOC100900200" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 813..1148 /gene="LOC100900200" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_003741520.2 - Metaseiulus occidentalis (western predatory mite) - NCBI
PREDICTED: Brassica rapa protein argonaute 6 (LOC103857461), transcript variant X2, mRNA. (3135 bp)
misc_feature 214..2799 /gene="LOC103857461" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 250..753 /gene="LOC103857461" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature <859..933 /gene="LOC103857461" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 934..1278 /gene="LOC103857461" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_009134648.2 - Brassica rapa - NCBI
PREDICTED: Brassica rapa protein argonaute 6 (LOC103857461), transcript variant X1, mRNA. (3112 bp)
misc_feature 191..2776 /gene="LOC103857461" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 227..730 /gene="LOC103857461" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature <836..910 /gene="LOC103857461" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 911..1255 /gene="LOC103857461" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_009134647.2 - Brassica rapa - NCBI
PREDICTED: Pyrus x bretschneideri protein argonaute 10 (LOC103964752), transcript variant X3, mRNA. (3278 bp)
misc_feature 353..2827 /gene="LOC103964752" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature <353..691 /gene="LOC103964752" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 722..871 /gene="LOC103964752" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 872..1216 /gene="LOC103964752" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_009377724.2 - Pyrus x bretschneideri - NCBI
PREDICTED: Atta colombica protein argonaute-2 (LOC108686046), transcript variant X4, mRNA. (3375 bp)
misc_feature 170..2623 /gene="LOC108686046" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 254..667 /gene="LOC108686046" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 698..847 /gene="LOC108686046" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 848..1210 /gene="LOC108686046" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_018191101.1 - Atta colombica - NCBI
PREDICTED: Brassica rapa protein argonaute 5 (LOC103829691), mRNA. (3275 bp)
misc_feature 378..2945 /gene="LOC103829691" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 411..839 /gene="LOC103829691" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 870..1019 /gene="LOC103829691" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1029..1358 /gene="LOC103829691" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_009105380.2 - Brassica rapa - NCBI
PREDICTED: Corvus brachyrhynchos argonaute 2, RISC catalytic component (AGO2), transcript variant X2, mRNA. (14168 bp)
misc_feature 105..2606 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 114..530 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 561..710 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 711..1073 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_008643070.2 - Corvus brachyrhynchos (American crow) - NCBI
PREDICTED: Lepidothrix coronata argonaute 1, RISC catalytic component (AGO1), mRNA. (6747 bp)
misc_feature 148..2640 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 148..564 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 595..744 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 745..1107 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017828282.1 - Lepidothrix coronata (blue-crowned manakin) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/Argonaute+%22PAZ+domain%22
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.108 | 0.108 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.134 | 0.026 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.273 | 0.139 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.282 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]