GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-07-19 07:03:28, GGRNA : RefSeq release 88 (May, 2018)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated...
XM_024651321.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not...
XM_024650915.1 - Strongyloides ratti - NCBI
Strongyloides ratti Protein argonaute-2 (SRAE_0000056900), partial mRNA. (846 bp)
codon_start=1 /product="Protein argonaute-2" /protein_id="XP_024500654.1" /db_xref="GeneID:36373813" /db_xref="InterPro:IPR003100" /db_xref="UniProtKB/TrEMBL:A0A090KV99" /translation="MNSQLFFLSIVALEKKNVCRFALSKANELSGNFGNDKLFYAYDGVKNLITNHLLNIDEFVIEREKLGIQYKSIFKNGSVRIFFEKTTRYHEIDLSVYASYLIVTQQALNDKNAGGGGYVQLNGEKSLTESSSFLKYENLRIGLGRIIVGSFTENIKFTNIDEPCFVLSINASKNVYYKSELLDKIIKDEIFRRNVPRLLKDFNAEINDSNIKGVHFETVYRKNGDIIKFRHDLHNHSTIDTIIDMKDGSQKSFAEYFQNKFNIQLKYPVWPLFVYKIHVTN" misc_feature 565..828 /locus_tag="SRAE_56900" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
XM_024646477.1 - Strongyloides ratti - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16204) partial mRNA. (2352 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2352 /gene="AGO16204" /locus_tag="LACBIDRAFT_315429" /db_xref="GeneID:6074035" CDS 1..2352 /gene="AGO16204" /locus_tag="LACBIDRAFT_315429" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001878380.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6074035" /translation="...
XM_001878345.1 - Laccaria bicolor S238N-H82 - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein partial mRNA. (2898 bp)
Qualifiers source 1..2898 /organism="Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2898 /locus_tag="LACBIDRAFT_295925" /db_xref="GeneID:6085310" CDS 1..2898 /locus_tag="LACBIDRAFT_295925" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001889672.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6085310" /translation="...
XM_001889637.1 - Laccaria bicolor S238N-H82 - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16202) partial mRNA. (2715 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2715 /gene="AGO16202" /locus_tag="LACBIDRAFT_311854" /db_xref="GeneID:6072122" CDS 1..2715 /gene="AGO16202" /locus_tag="LACBIDRAFT_311854" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001876710.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6072122" /translation="...
XM_001876675.1 - Laccaria bicolor S238N-H82 - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16205) partial mRNA. (2766 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2766 /gene="AGO16205" /locus_tag="LACBIDRAFT_311445" /db_xref="GeneID:6072513" CDS 1..2766 /gene="AGO16205" /locus_tag="LACBIDRAFT_311445" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001876972.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6072513" /translation="...
XM_001876937.1 - Laccaria bicolor S238N-H82 - NCBI
Caenorhabditis remanei hypothetical protein (CRE_14480) mRNA, complete cds. (2583 bp)
misc_feature 16..2415 /locus_tag="CRE_14480" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 73..468 /locus_tag="CRE_14480" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 499..651 /locus_tag="CRE_14480" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 652..1014 /locus_tag="CRE_14480" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003107282.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei hypothetical protein (CRE_08398) mRNA, complete cds. (2571 bp)
misc_feature 79..2424 /locus_tag="CRE_08398" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 79..477 /locus_tag="CRE_08398" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 508..672 /locus_tag="CRE_08398" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 676..1041 /locus_tag="CRE_08398" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003101857.1 - Caenorhabditis remanei - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16201) partial mRNA. (2886 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2886 /gene="AGO16201" /locus_tag="LACBIDRAFT_317035" /db_xref="GeneID:6074423" CDS 1..2886 /gene="AGO16201" /locus_tag="LACBIDRAFT_317035" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001878739.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6074423" /translation="...
XM_001878704.1 - Laccaria bicolor S238N-H82 - NCBI
Caenorhabditis remanei hypothetical protein (CRE_09584) mRNA, complete cds. (2709 bp)
misc_feature 73..2559 /locus_tag="CRE_09584" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 157..573 /locus_tag="CRE_09584" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 604..774 /locus_tag="CRE_09584" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 775..1140 /locus_tag="CRE_09584" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003103769.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei hypothetical protein (CRE_25241) mRNA, complete cds. (3177 bp)
misc_feature 250..2931 /locus_tag="CRE_25241" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 316..750 /locus_tag="CRE_25241" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 841..963 /locus_tag="CRE_25241" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1174..1506 /locus_tag="CRE_25241" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003113068.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei CRE-ALG-1 protein (Cre-alg-1) mRNA, complete cds. (3069 bp)
feature 424..2865 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 424..840 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature <1009..1110 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1111..1476 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing...
XM_003105478.1 - Caenorhabditis remanei - NCBI
PREDICTED: Pan paniscus argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (3100 bp)
misc_feature 503..844 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="AGO3" /note="Piwi_ago-...
XM_024928002.1 - Pan paniscus (pygmy chimpanzee) - NCBI
PREDICTED: Pan paniscus argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (2848 bp)
misc_feature 251..592 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(386..388,431..433,473..475,485..487,539..541, 560..562,566..568) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 725..2002 /gene="AGO3" /note="Piwi_ago-...
XM_024928006.1 - Pan paniscus (pygmy chimpanzee) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X9, mRNA. (15052 bp)
misc_feature 114..455 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(249..251,294..296,336..338,348..350,402..404, 423..425,429..431) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 588..1865 /gene="AGO3" /note="Piwi_ago-...
XM_025041517.1 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (15118 bp)
misc_feature 180..521 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(315..317,360..362,402..404,414..416,468..470, 489..491,495..497) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 654..1931 /gene="AGO3" /note="Piwi_ago-...
XM_025041516.1 - Pteropus alecto (black flying fox) - NCBI
Strongyloides ratti Protein argonaute-4 (SRAE_0000025800), partial mRNA. (2871 bp)
misc_feature 538..756 /locus_tag="SRAE_25800" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 784..963 /locus_tag="SRAE_25800" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 973..1332 /locus_tag="SRAE_25800" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_024646124.1 - Strongyloides ratti - NCBI
PREDICTED: Homo sapiens argonaute 4, RISC catalytic component (AGO4), transcript variant X8, mRNA. (7168 bp)
misc_feature <1419..1697 /gene="AGO4" /gene_synonym="EIF2C4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1491..1493,1536..1538,1578..1580,1590..1592, 1644..1646,1665..1667,1671..1673) /gene="AGO4" /gene_synonym="EIF2C4" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="...
Synonym: EIF2C4
XM_024453795.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X9, mRNA. (2842 bp)
misc_feature <360..578 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(372..374,417..419,459..461,471..473,525..527, 546..548,552..554) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000528.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Strongyloides ratti Protein argonaute-4 (SRAE_X000201400), partial mRNA. (2901 bp)
misc_feature 385..777 /locus_tag="SRAE_X000201400" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 805..996 /locus_tag="SRAE_X000201400" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1000..1362 /locus_tag="SRAE_X000201400" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_...
XM_024643007.1 - Strongyloides ratti - NCBI
PREDICTED: Desmodus rotundus argonaute 4, RISC catalytic component (AGO4), transcript variant X4, mRNA. (4735 bp)
misc_feature 1884..2273 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 2304..2456 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 2457..2819 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_024554566.1 - Desmodus rotundus (common vampire bat) - NCBI
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X10, mRNA. (3892 bp)
misc_feature <1410..1628 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1422..1424,1467..1469,1509..1511,1521..1523, 1575..1577,1596..1598,1602..1604) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="...
Synonym: EIF2C3
XM_005270576.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Macaca nemestrina argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (3220 bp)
misc_feature 503..844 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="AGO3" /note="Piwi_ago-...
XM_011763420.1 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Macaca nemestrina argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (3047 bp)
misc_feature 330..671 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(465..467,510..512,552..554,564..566,618..620, 639..641,645..647) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 804..2081 /gene="AGO3" /note="Piwi_ago-...
XM_011763423.1 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Macaca nemestrina argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (3095 bp)
misc_feature 378..719 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(513..515,558..560,600..602,612..614,666..668, 687..689,693..695) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 852..2129 /gene="AGO3" /note="Piwi_ago-...
XM_011763422.1 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (15115 bp)
misc_feature 177..518 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(312..314,357..359,399..401,411..413,465..467, 486..488,492..494) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 651..1928 /gene="AGO3" /note="Piwi_ago-...
XM_015598969.2 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (2714 bp)
misc_feature 109..450 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(244..246,289..291,331..333,343..345,397..399, 418..420,424..426) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000526.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (2893 bp)
misc_feature 288..629 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(423..425,468..470,510..512,522..524,576..578, 597..599,603..605) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000527.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (2755 bp)
misc_feature 150..491 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(285..287,330..332,372..374,384..386,438..440, 459..461,465..467) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000525.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (2750 bp)
misc_feature 145..486 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(280..282,325..327,367..369,379..381,433..435, 454..456,460..462) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_011540882.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (2921 bp)
misc_feature 316..657 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(451..453,496..498,538..540,550..552,604..606, 625..627,631..633) /gene="AGO3" /gene_synonym="EIF2C3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
Synonym: EIF2C3
XM_017000524.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Macaca nemestrina argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (3897 bp)
misc_feature 1180..1521 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1315..1317,1360..1362,1402..1404,1414..1416, 1468..1470,1489..1491,1495..1497) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1654..2931 /gene="...
XM_011763421.1 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Pan paniscus argonaute 2, RISC catalytic component (AGO2), mRNA. (11699 bp)
misc_feature 356..580 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 608..760 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 761..1123 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_008972881.3 - Pan paniscus (pygmy chimpanzee) - NCBI
PREDICTED: Pan paniscus argonaute 4, RISC catalytic component (AGO4), transcript variant X3, mRNA. (6955 bp)
misc_feature 308..562 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 593..745 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 746..1108 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_008965041.2 - Pan paniscus (pygmy chimpanzee) - NCBI
PREDICTED: Pteropus alecto protein argonaute-1 (LOC102879797), transcript variant X6, mRNA. (3644 bp)
misc_feature 233..385 /gene="LOC102879797" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 386..748 /gene="LOC102879797" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(542..544,587..589,629..631,641..643,695..697, 716..718,722..724) /gene="LOC102879797" /note...
XM_025041367.1 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Bos taurus argonaute RISC catalytic component 3 (AGO3), transcript variant X8, mRNA. (15507 bp)
misc_feature 242..394 /gene="AGO3" /gene_synonym="EIF2C3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 395..757 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order...
Synonym: EIF2C3
XM_024985245.1 - Bos taurus (cattle) - NCBI
Caenorhabditis remanei hypothetical protein (CRE_20331) mRNA, complete cds. (2895 bp)
misc_feature 178..>495 /locus_tag="CRE_20331" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 925..1257 /locus_tag="CRE_20331" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1066..1068,1111..1113,1141..1143,1153..1155, 1207..1209,1228..1230,1234..1236) /...
XM_003106040.1 - Caenorhabditis remanei - NCBI
PREDICTED: Desmodus rotundus argonaute 2, RISC catalytic component (AGO2), mRNA. (3259 bp)
misc_feature 247..471 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 499..651 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 652..1014 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_024572169.1 - Desmodus rotundus (common vampire bat) - NCBI
PREDICTED: Bos taurus argonaute RISC catalytic component 3 (AGO3), transcript variant X9, mRNA. (16145 bp)
misc_feature 916..1068 /gene="AGO3" /gene_synonym="EIF2C3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1069..1431 /gene="AGO3" /gene_synonym="EIF2C3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order...
Synonym: EIF2C3
XM_024985247.1 - Bos taurus (cattle) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (15672 bp)
misc_feature 248..532 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 560..712 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 713..1075 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025041515.1 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (15938 bp)
misc_feature 514..798 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 826..978 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 979..1341 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025041514.1 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Oncorhynchus tshawytscha protein argonaute-4 (LOC112229915), transcript variant X2, mRNA. (5665 bp)
misc_feature 247..609 /gene="LOC112229915" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(403..405,448..450,490..492,502..504,556..558, 577..579,583..585) /gene="LOC112229915" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 748..2055 /gene="...
XM_024396059.1 - Oncorhynchus tshawytscha (Chinook salmon) - NCBI
PREDICTED: Macaca nemestrina argonaute 2, RISC catalytic component (AGO2), mRNA. (15389 bp)
misc_feature 1212..1436 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 1464..1616 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1617..1979 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_011752382.2 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Pteropus alecto argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (15635 bp)
misc_feature 211..495 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 523..675 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 676..1038 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025041513.1 - Pteropus alecto (black flying fox) - NCBI
PREDICTED: Macaca nemestrina argonaute 4, RISC catalytic component (AGO4), transcript variant X5, mRNA. (6785 bp)
misc_feature 132..386 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 417..569 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 570..932 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_011763409.2 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Bos taurus argonaute 4, RISC catalytic component (AGO4), transcript variant X2, mRNA. (6459 bp)
misc_feature 320..574 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 605..757 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 758..1120 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_024990227.1 - Bos taurus (cattle) - NCBI
PREDICTED: Macaca nemestrina argonaute 4, RISC catalytic component (AGO4), transcript variant X4, mRNA. (6933 bp)
misc_feature 280..534 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 565..717 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 718..1080 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_011763408.2 - Macaca nemestrina (pig-tailed macaque) - NCBI
PREDICTED: Oncorhynchus tshawytscha protein argonaute-4 (LOC112229915), transcript variant X1, mRNA. (5731 bp)
misc_feature 247..627 /gene="LOC112229915" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(421..423,466..468,508..510,520..522,574..576, 595..597,601..603) /gene="LOC112229915" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 766..2121 /gene="...
XM_024396058.1 - Oncorhynchus tshawytscha (Chinook salmon) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/Argonaute+%22PAZ+domain%22
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.100 | 0.100 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.150 | 0.050 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.444 | 0.294 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.453 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]