GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-09-24 13:54:05, GGRNA : RefSeq release 83 (Jul, 2017)



Matches are highlighted with green background. Overlapping matches are dark colored.

Aspergillus fischeri NRRL 181 PAZ domain protein partial mRNA. (1410 bp)
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_001263935.1 - Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) - NCBI
PREDICTED: Diaphorina citri protein argonaute-4-like (LOC103524044), partial mRNA. (231 bp)
alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GeneID:103524044" /translation="MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC" misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the...
XM_008489050.1 - Diaphorina citri (Asian citrus psyllid) - NCBI
PREDICTED: Rattus norvegicus protein argonaute-4-like (LOC102554576), mRNA. (968 bp)
LOC102554576" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_006227744.1" /db_xref="GeneID:102554576" /db_xref="RGD:7706370" /translation="MEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGHLSEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNGQDDQPVIKRMWITCKTIWEPYMMV" misc_feature 570..719 /gene="LOC102554576" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 720..>902 /gene="LOC102554576" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-...
XM_006227682.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Brugia malayi PAZ domain containing protein partial mRNA. (1245 bp)
misc_feature 832..1170 /locus_tag="Bm1_18705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(979..981,1024..1026,1051..1053,1063..1065, 1117..1119,1138..1140,1144..1146) /locus_tag="Bm1_18705" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN // REFERENCE...
XM_001895163.1 - Brugia malayi - NCBI
PREDICTED: Xenopus tropicalis argonaute 2, RISC catalytic component (ago2), transcript variant X1, mRNA. (4811 bp)
feature 409..2913 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 418..837 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 868..1017 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1018..1380 /gene="ago2" /gene_synonym="Argonaute2; eif2c2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the...
Synonym: Argonaute2; eif2c2
XM_012964517.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Rattus norvegicus argonaute 4, RISC catalytic component (Ago4), mRNA. (3737 bp)
misc_feature <914..1132 /gene="Ago4" /gene_synonym="Eif2c4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(926..928,971..973,1013..1015,1025..1027,1079..1081, 1100..1102,1106..1108) /gene="Ago4" /gene_synonym="Eif2c4" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD...
Synonym: Eif2c4
NM_001106686.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (3100 bp)
misc_feature 503..844 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="AGO3" /note="Piwi_ago-...
XM_016959144.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (3145 bp)
misc_feature 548..889 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(683..685,728..730,770..772,782..784,836..838, 857..859,863..865) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1022..2299 /gene="AGO3" /note="Piwi_ago-...
XM_016959152.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Manis javanica argonaute 1, RISC catalytic component (AGO1), transcript variant X5, mRNA. (6849 bp)
misc_feature 177..326 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 327..689 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(483..485,528..530,570..572,582..584,636..638, 657..659,663..665) /gene="AGO1" /note="nucleic acid-binding...
XM_017660999.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Mus musculus argonaute RISC catalytic subunit 4 (Ago4), transcript variant X4, mRNA. (3265 bp)
misc_feature <508..636 /gene="Ago4" /gene_synonym="5730550L01Rik; AI481660; Eif2c4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature 775..2082 /gene="Ago4" /gene_synonym="5730550L01Rik; AI481660; Eif2c4" /note="Piwi_ago-like: PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-...
Synonym: 5730550L01Rik; AI481660; Eif2c4
XM_006503483.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X7, mRNA. (2489 bp)
misc_feature 109..450 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(244..246,289..291,331..333,343..345,397..399, 418..420,424..426) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 583..1860 /gene="...
XM_017501083.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X3, mRNA. (2883 bp)
misc_feature 503..844 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="...
XM_017501079.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X5, mRNA. (2916 bp)
misc_feature 536..877 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(671..673,716..718,758..760,770..772,824..826, 845..847,851..853) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1010..2287 /gene="...
XM_017501081.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X4, mRNA. (2964 bp)
misc_feature 584..925 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(719..721,764..766,806..808,818..820,872..874, 893..895,899..901) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1058..2335 /gene="...
XM_017501080.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X6, mRNA. (3030 bp)
misc_feature 650..991 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(785..787,830..832,872..874,884..886,938..940, 959..961,965..967) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1124..2401 /gene="...
XM_017501082.1 - Cebus capucinus imitator - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X10, mRNA. (12271 bp)
misc_feature 185..334 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 335..697 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(491..493,536..538,578..580,590..592,644..646, 665..667,671..673) /gene="AGO1" /note="nucleic acid-binding...
XM_009453704.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Papio anubis protein argonaute-3 (LOC101005189), transcript variant X7, mRNA. (2928 bp)
misc_feature 332..673 /gene="LOC101005189" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(467..469,512..514,554..556,566..568,620..622, 641..643,647..649) /gene="LOC101005189" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 806..2083 /gene="...
XM_009204736.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis protein argonaute-3 (LOC101005189), transcript variant X6, mRNA. (2976 bp)
misc_feature 380..721 /gene="LOC101005189" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(515..517,560..562,602..604,614..616,668..670, 689..691,695..697) /gene="LOC101005189" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 854..2131 /gene="...
XM_009204731.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X9, mRNA. (12367 bp)
misc_feature 281..430 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 431..793 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(587..589,632..634,674..676,686..688,740..742, 761..763,767..769) /gene="AGO1" /note="nucleic acid-binding...
XM_009453699.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X3, mRNA. (4706 bp)
misc_feature 139..2574 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 139..498 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 529..678 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 679..1041 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017649847.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X2, mRNA. (4703 bp)
misc_feature 136..2571 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 136..495 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 526..675 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 676..1038 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017649846.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X4, mRNA. (4744 bp)
misc_feature 177..2612 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 177..536 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 567..716 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 717..1079 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017649848.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Manis javanica argonaute 2, RISC catalytic component (AGO2), transcript variant X1, mRNA. (4757 bp)
misc_feature 190..2625 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 190..549 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 580..729 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 730..1092 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017649845.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (3187 bp)
misc_feature <122..388 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 419..568 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 569..931 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_016959129.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Poecilia reticulata protein argonaute-3-like (LOC103473053), mRNA. (2801 bp)
misc_feature 343..2517 /gene="LOC103473053" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 343..786 /gene="LOC103473053" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 817..966 /gene="LOC103473053" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 967..1329 /gene="LOC103473053" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_008422983.2 - Poecilia reticulata (guppy) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (3219 bp)
misc_feature <154..420 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 451..600 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 601..963 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_016959137.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 4, RISC catalytic component (AGO4), transcript variant X5, mRNA. (7078 bp)
misc_feature <413..676 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 710..859 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 860..1222 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_016959078.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Manis javanica argonaute 1, RISC catalytic component (AGO1), transcript variant X3, mRNA. (7414 bp)
misc_feature 286..2787 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 286..702 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 733..882 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 883..1245 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017660997.1 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Capra hircus argonaute 2, RISC catalytic component (AGO2), mRNA. (14235 bp)
misc_feature 182..2683 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 191..607 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 638..787 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 788..1150 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_018058614.1 - Capra hircus (goat) - NCBI
PREDICTED: Pan troglodytes argonaute 2, RISC catalytic component (AGO2), transcript variant X3, mRNA. (15409 bp)
misc_feature 1080..3515 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 1080..1439 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 1470..1619 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1620..1982 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain...
XM_016959913.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 4, RISC catalytic component (AGO4), transcript variant X1, mRNA. (6883 bp)
misc_feature 59..2596 /gene="AGO4" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 68..481 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 515..664 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 665..1027 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_016959062.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Mus musculus argonaute RISC catalytic subunit 3 (Ago3), transcript variant X6, mRNA. (15516 bp)
misc_feature <1017..1235 /gene="Ago3" /gene_synonym="AW048688; C130014L07Rik; Eif2c3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1029..1031,1074..1076,1116..1118,1128..1130, 1182..1184,1203..1205,1209..1211) /gene="Ago3" /gene_synonym="AW048688; C130014L07Rik; Eif2c3" /note="nucleic acid-binding...
Synonym: AW048688; C130014L07Rik; Eif2c3
XM_017320100.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (3510 bp)
misc_feature 403..2787 /gene="AGO3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 403..846 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 859..1254 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_...
XM_009453725.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Capra hircus argonaute 1, RISC catalytic component (AGO1), transcript variant X1, mRNA. (8781 bp)
misc_feature 426..2927 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 426..842 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 873..1022 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1023..1385 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has...
XM_018041500.1 - Capra hircus (goat) - NCBI
PREDICTED: Cebus capucinus imitator argonaute 2, RISC catalytic component (AGO2), mRNA. (3545 bp)
misc_feature 237..2672 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 237..596 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 627..776 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 777..1139 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_017501692.1 - Cebus capucinus imitator - NCBI
PREDICTED: Pan troglodytes argonaute 4, RISC catalytic component (AGO4), transcript variant X4, mRNA. (7147 bp)
misc_feature 323..2860 /gene="AGO4" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 332..745 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 779..928 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 929..1291 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_016959071.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X2, mRNA. (3335 bp)
misc_feature 443..2962 /gene="AGO3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 443..886 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 917..1066 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1067..1429 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has...
XM_016959123.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Phoenix dactylifera protein argonaute 10 (LOC103698685), partial mRNA. (2512 bp)
misc_feature <4..144 /gene="LOC103698685" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 175..324 /gene="LOC103698685" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 325..666 /gene="LOC103698685" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db...
XM_008780726.2 - Phoenix dactylifera (date palm) - NCBI
PREDICTED: Papio anubis argonaute 4, RISC catalytic component (AGO4), transcript variant X2, mRNA. (6568 bp)
misc_feature <271..534 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 568..717 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 718..1080 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009204706.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Papio anubis argonaute 4, RISC catalytic component (AGO4), transcript variant X1, mRNA. (6942 bp)
misc_feature <645..908 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 942..1091 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1092..1454 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009204700.2 - Papio anubis (olive baboon) - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X4, mRNA. (12782 bp)
misc_feature 306..2798 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 306..722 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 753..902 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 903..1265 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_513312.5 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Oryctolagus cuniculus argonaute 3, RISC catalytic component (AGO3), transcript variant X1, mRNA. (6583 bp)
misc_feature 293..2848 /gene="AGO3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 329..772 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 803..952 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 953..1315 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_008273686.2 - Oryctolagus cuniculus (rabbit) - NCBI
PREDICTED: Mus musculus argonaute RISC catalytic subunit 3 (Ago3), transcript variant X5, mRNA. (16041 bp)
misc_feature <1542..1760 /gene="Ago3" /gene_synonym="AW048688; C130014L07Rik; Eif2c3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1554..1556,1599..1601,1641..1643,1653..1655, 1707..1709,1728..1730,1734..1736) /gene="Ago3" /gene_synonym="AW048688; C130014L07Rik; Eif2c3" /note="nucleic acid-binding...
Synonym: AW048688; C130014L07Rik; Eif2c3
XM_006502921.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Capra hircus argonaute 1, RISC catalytic component (AGO1), transcript variant X2, mRNA. (8772 bp)
misc_feature 426..2918 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 426..842 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 873..1022 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1023..1385 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has...
XM_005678708.3 - Capra hircus (goat) - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X3, mRNA. (12791 bp)
misc_feature 306..2807 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 306..722 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 753..902 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 903..1265 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_009453691.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X2, mRNA. (12830 bp)
misc_feature 306..2846 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 306..722 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 753..902 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 903..1265 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_009453685.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Mus musculus argonaute RISC catalytic subunit 3 (Ago3), transcript variant X3, mRNA. (14844 bp)
misc_feature 222..563 /gene="Ago3" /gene_synonym="AW048688; C130014L07Rik; Eif2c3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(357..359,402..404,444..446,456..458,510..512, 531..533,537..539) /gene="Ago3" /gene_synonym="AW048688; C130014L07Rik; Eif2c3" /note="nucleic acid-binding interface...
Synonym: AW048688; C130014L07Rik; Eif2c3
XM_006502919.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X1, mRNA. (12839 bp)
misc_feature 306..2855 /gene="AGO1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 306..722 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 753..902 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 903..1265 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_009453676.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Manacus vitellinus argonaute 2, RISC catalytic component (AGO2), transcript variant X1, mRNA. (3558 bp)
misc_feature 165..2669 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 174..593 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 624..773 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 774..1136 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_018075864.1 - Manacus vitellinus (golden-collared manakin) - NCBI
PREDICTED: Phoenix dactylifera protein argonaute MEL1-like (LOC103698577), mRNA. (3129 bp)
misc_feature 196..2802 /gene="LOC103698577" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 223..660 /gene="LOC103698577" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 691..837 /gene="LOC103698577" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 841..1185 /gene="LOC103698577" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_008780612.2 - Phoenix dactylifera (date palm) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.074 | 0.074 | count_done;*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.086 | 0.012 | count_done;*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.255 | 0.169 | search_done;*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.264 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]