LOCUS       XM_031906355             628 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis beta-microseminoprotein
            (LOC101733634), transcript variant X4, mRNA.
ACCESSION   XM_031906355
VERSION     XM_031906355.1
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030683.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..628
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="7"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..628
                     /gene="LOC101733634"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 13 ESTs, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     11 samples with support for all annotated introns"
                     /db_xref="GeneID:101733634"
     CDS             138..473
                     /gene="LOC101733634"
                     /codon_start=1
                     /product="beta-microseminoprotein isoform X3"
                     /protein_id="XP_031762215.1"
                     /db_xref="GeneID:101733634"
                     /translation="

MCILASVVALGILVATCNAACFNQPPELKENLEGCLYKDELHELGSEFRTKDCYDCTCSMDGSMRCCQAYGTPVGYDKKKCKAIFNKKTCTYRVVEKKDRSKECEGHAMVG"

     misc_feature    <261..449
                     /gene="LOC101733634"
                     /note="Beta-microseminoprotein (PSP-94); Region: PSP94;
                     pfam05825"
                     /db_xref="CDD:283482"
ORIGIN      

agcagggctcacagtgctgtatctgtaacaactggaaacataatggaaaactgtgttgctcaattcttatctgatttgctataagtagggggagagcagggctcactgtgtctgtatctgcaacaactagaagaataatgtgcattttggcttctgtggttgcccttggcattttggtggcaacatgtaatgccgcctgcttcaatcagccgcctgaactgaaggaaaacctggaaggttgcctttataaagatgagctgcatgaattggggagtgaatttagaactaaagattgctatgactgtacctgttccatggacggctcaatgagatgttgccaagcctatggtaccccagtgggttatgataagaaaaagtgtaaagctatttttaataagaaaacctgcacttaccgtgttgtggaaaagaaagatcgctcaaaggaatgtgagggtcatgctatggttggataaagtggccgtctccttggggcagagccttcgtgcttacaacatttatatccacattgttttttgcatgaacttaaatcagatacttaaatacagatatattacatgaataaagtgcatatgaataaccaagaaagtaaagtcattaaaacagcaaa

//