ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-20 15:00:51, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_031895379 701 bp mRNA linear VRT 18-DEC-2019
DEFINITION PREDICTED: Xenopus tropicalis ribosomal protein L9 (rpl9),
transcript variant X1, mRNA.
ACCESSION XM_031895379
VERSION XM_031895379.1
DBLINK BioProject: PRJNA205740
KEYWORDS RefSeq.
SOURCE Xenopus tropicalis (tropical clawed frog)
ORGANISM Xenopus tropicalis
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
Xenopus; Silurana.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_030677.2) annotated using gene prediction method: Gnomon,
supported by mRNA and EST evidence.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Xenopus tropicalis Annotation
Release 104
Annotation Version :: 104
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.3
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..701
/organism="Xenopus tropicalis"
/mol_type="mRNA"
/strain="Nigerian"
/db_xref="taxon:8364"
/chromosome="1"
/sex="female"
/tissue_type="liver and blood"
/dev_stage="adult"
/note="F17 inbred"
gene 1..701
/gene="rpl9"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 mRNA, 629 ESTs, 16 Proteins, and
100% coverage of the annotated genomic feature by RNAseq
alignments, including 129 samples with support for all
annotated introns"
/db_xref="GeneID:100379906"
/db_xref="Xenbase:XB-GENE-964745"
CDS 36..644
/gene="rpl9"
/codon_start=1
/product="60S ribosomal protein L9 isoform X1"
/protein_id="XP_031751239.1"
/db_xref="GeneID:100379906"
/db_xref="Xenbase:XB-GENE-964745"
/translation="
MVFFFYISDRMKTILSNQIVDIPENVDISLKGRTVTVKGPRGVLRKNFNHINVELCLLGKKKRRLRVDKWWGNRKELATVRTICSHVQNMVKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRSGVACALSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQVEE"
misc_feature 66..638
/gene="rpl9"
/note="60S ribosomal protein L6; Provisional; Region:
PTZ00027"
/db_xref="CDD:240234"
ORIGIN
cattttttaggcggtttgtgattgctatatgtataatggtattttttttttatatttctgatagaatgaagaccattctcagcaaccagattgttgacatcccagagaatgttgacatctctctgaagggccgtacagttactgtaaaggggcccagaggtgtcctgcggaaaaactttaaccacatcaatgttgagctgtgtcttctgggcaagaagaagaggaggctccgggttgacaaatggtggggtaacagaaaagaactggccacagtgcgcaccatctgcagtcatgtgcaaaacatggtgaaaggagtcacactgggctttcgttacaaaatgagatctgtgtatgctcactttcccatcaacgttgtcattcaggagaatggatctcttgtggaaataagaaacttcttgggtgaaaagtatatccgcagggttcgcatgagatcaggtgttgcatgcgccttatcccaagcccagaaagatgagctgattcttgaaggcaatgacattgaacttgtatcaaactctgctgccttgatccagcaagccaccacagtaaagaataaggatatcagaaaattcttggatggtatctacgtatccgaaaagggtacagtacagcaggttgaagaataaaagcctgcaaaagtctggttcctgtactgttccaaaaataaagtccctttatctaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]