LOCUS       XM_012969620             802 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis bolA family member 1 (bola1), mRNA.
ACCESSION   XM_012969620
VERSION     XM_012969620.3
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030684.2) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 18, 2019 this sequence version replaced XM_012969620.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..802
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="8"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..802
                     /gene="bola1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 24 ESTs, 4 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 128 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100170577"
                     /db_xref="Xenbase:XB-GENE-991613"
     CDS             122..565
                     /gene="bola1"
                     /codon_start=1
                     /product="bolA-like protein 1"
                     /protein_id="XP_012825074.2"
                     /db_xref="GeneID:100170577"
                     /db_xref="Xenbase:XB-GENE-991613"
                     /translation="

MLMLPLSLLRTKCRIPWTLVTLPYSRSQLYMERPVENAIRSKLTETLKPSHLEVLNESYMHAVPKGSETHFKVVVVSESFLGKSLIQRHRLVNELLKDELAGPVHALSIQAKTPQQWEENPAISKSPACMGGSKHDPEMGRKLGTQV"

     misc_feature    221..478
                     /gene="bola1"
                     /note="DNA-binding global transcriptional regulator BolA,
                     affects cell shape, cell division and biofilm formation
                     [Transcription, Signal transduction mechanisms]; Region:
                     BolA; COG0271"
                     /db_xref="CDD:440041"
ORIGIN      

aattccctacgagacaggacgcgtcctctgacagaacgcggaaatacgctctgacctaagattggctgttgaccataggattcccgggccgaaccataccaggacgcctcagctccttcccatgctgatgctaccgttgagcctgctccgaactaaatgcaggataccttggacactggtcacattgccgtattctagatcacagctttacatggagaggccagtggagaacgctatccgatccaaactgactgagaccctgaagcccagccacttggaggtgctgaatgagagctatatgcatgcggtgcccaagggctcggaaacgcactttaaggtggtggtggtgtcggagagcttcctcggcaagtctctgatccagaggcatagactggtgaatgaactgctgaaggacgagttagctggtcctgttcatgccttgtccatccaagccaaaacccctcaacaatgggaggaaaaccctgccatcagcaaaagcccagcctgcatggggggctcgaagcatgaccctgagatgggcaggaaacttggcactcaagtgtagatgtgacccctctaataatgggaacttatatgtgagataaagcaaaacatctgataactacattttactatttctgtaaagaactgtgaaaattgttagataaacctgtttgtgaccagctgtgggctgcgtacaaaatgggtgcagagcgcttctgtacgtttatgtggtagtcaataatgggttacggtgatgtccctgtcaaatgtaggaattaaatcattatgtgctgataaa

//