LOCUS       XM_002938447             714 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis claudin 17 gene 1 (cldn17.1), mRNA.
ACCESSION   XM_002938447
VERSION     XM_002938447.1
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030678.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="2"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..714
                     /gene="cldn17.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 6 Proteins"
                     /db_xref="GeneID:100487058"
                     /db_xref="Xenbase:XB-GENE-22166252"
     CDS             1..714
                     /gene="cldn17.1"
                     /codon_start=1
                     /product="claudin-8"
                     /protein_id="XP_002938493.1"
                     /db_xref="GeneID:100487058"
                     /db_xref="Xenbase:XB-GENE-22166252"
                     /translation="

MAYFILHILGIILGAIGVLLTIIVTSMAQWRVSYMVEGNSMNCDKRIDGLYLSRWDGLWVTCVSKHQGSMQCNNYDSLVSITTDLKTGRVLMSFAVVIAIIAFIIAIVAFCFSRCCRGGEGSRYCLFITAGIGFILTAILVVIPISWTTSNIIFAINNPLCKTVQRQEIGEALLLGYPTILFLLITGAIFCWPYPRQERCNSIDSCSDSSIPKPAYIQCQTQDRMPPQAQYSRSQYI"

     misc_feature    16..570
                     /gene="cldn17.1"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      

atggcctacttcattctgcacatacttggcatcatcctgggggcaattggtgtgctacttaccattattgtcacatcaatggcccagtggagggtctcctacatggtggaaggcaactccatgaactgtgataaacgaattgatggactgtatctaagtcgctgggatggcttatgggtgacctgcgtgtccaagcaccaaggcagcatgcaatgcaataactacgattccctggtgtccatcactacggacttgaagactggcagagtgctgatgtccttcgcggtggtcatcgccattattgctttcatcattgccattgtcgctttctgcttctcccgatgctgcagaggaggagaggggagcagatactgcctgtttataacagctggaattggatttattttgaccgcaatccttgtagtgatcccaataagctggacaaccagcaacatcatcttcgccattaacaaccctctgtgcaaaacggtgcaacgacaagaaataggggaagctttgctccttggctatcccactatcctcttcctgctcatcacaggagccatattctgttggccatacccacgtcaagagagatgcaacagtattgattcctgttcagactcttctatcccaaaaccagcgtatatacagtgccagacccaggacagaatgccaccccaagctcaatattcccgaagccaatacatctaa

//