LOCUS       XM_002937792             877 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis EEF1A lysine methyltransferase 2
            (eef1akmt2), transcript variant X2, mRNA.
ACCESSION   XM_002937792
VERSION     XM_002937792.5
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030683.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 18, 2019 this sequence version replaced XM_002937792.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..877
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="7"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..877
                     /gene="eef1akmt2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 12 ESTs, 7 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 111 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100498530"
                     /db_xref="Xenbase:XB-GENE-1005689"
     CDS             126..788
                     /gene="eef1akmt2"
                     /codon_start=1
                     /product="EEF1A lysine methyltransferase 2 isoform X2"
                     /protein_id="XP_002937838.1"
                     /db_xref="GeneID:100498530"
                     /db_xref="Xenbase:XB-GENE-1005689"
                     /translation="

MTNEEEFSPSALGTKAHWDAVYSRELQSFKEYGDEGEIWFGEGSMARVIRWLNAHKVPQTASILDIGTGNGMLLVELAKSGYCNLTGIDYSSDAVELAKSICEKEGVSQNAQLQVTDFLEDFHPSQQFDVCLDKGTFDAVSLDPTGATEKREQYVRSLCQALKAQGLFIITSCNWTKEELLSQFGEEFEFKDELPTPTFSFGGKAGHSVTALVLQRRNHS"

     misc_feature    276..>641
                     /gene="eef1akmt2"
                     /note="SAM-dependent methyltransferase [Secondary
                     metabolites biosynthesis, transport and catabolism,
                     General function prediction only]; Region: SmtA; COG0500"
                     /db_xref="CDD:440266"
ORIGIN      

cctgtgctgacatcacctttagcgcctggatacccagcatgctttgcgtggcatgacgtgggaaagacgagacagccggtgttggcttcactttttcatattcggtctcatttccacccggtaacatgaccaatgaggaagaattttcgccgtcagcactgggtaccaaggcacactgggatgctgtttatagtcgagagcttcagtcatttaaggaatacggtgatgagggtgaaatatggttcggagaaggcagtatggcaagagttatccgatggctaaatgcacacaaagtaccacagactgcttccatacttgacattggaacaggaaatggcatgttactggtggaactggcaaagtctggctactgcaatctcactggcatagattatagcagtgatgctgtggaactagcgaaaagcatatgtgaaaaggagggggtctcccaaaatgcacagttgcaggtcacagattttcttgaagacttccatccatcacagcagtttgacgtttgcttggataaaggaacatttgacgcagtgagcttagatccgacaggtgcaacagagaagcgtgagcagtatgtgcggtcgctatgccaggccctaaaggcgcaggggctttttattataacttcctgcaactggaccaaggaggaactacttagtcagtttggggaagagtttgaattcaaggatgagcttccaacacccacatttagttttggaggcaaggcaggtcacagcgttactgcattggtattacagaggagaaaccactcttgagagacttggcaaaaacagaaaaatgtttatttattcattttttaattatatgcatttatgtattaaatatatttgattataaaaagaaa

//