LOCUS       XM_002933722            1611 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis trafficking protein particle complex
            6B (trappc6b), mRNA.
ACCESSION   XM_002933722
VERSION     XM_002933722.5
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030684.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 18, 2019 this sequence version replaced XM_002933722.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1611
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="8"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..1611
                     /gene="trappc6b"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 ESTs, 13 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 96 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:779535"
                     /db_xref="Xenbase:XB-GENE-1000721"
     CDS             139..633
                     /gene="trappc6b"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 6B"
                     /protein_id="XP_002933768.1"
                     /db_xref="GeneID:779535"
                     /db_xref="Xenbase:XB-GENE-1000721"
                     /translation="

MNKQDMADEALFLLLHNEVISCVYKAGGDQGDAENGKCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFVCKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLITQMSAGKQYLEHAPKYLAFSCGLIRGGLSNLGIKSIVTAEVSVMPACKFQVMIQKL"

     misc_feature    160..624
                     /gene="trappc6b"
                     /note="Trs33 subunit of the TRAPP complex; Region:
                     TRAPPC6A_Trs33; cd14944"
                     /db_xref="CDD:271347"
     misc_feature    order(166..168,175..177,187..189,463..468,496..498,
                     508..510)
                     /gene="trappc6b"
                     /note="synbindin interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271347"
     misc_feature    order(169..174,178..186,190..195,202..204,259..261,
                     271..273,280..285,292..297,304..306,379..381,388..390,
                     448..450,517..519)
                     /gene="trappc6b"
                     /note="BET3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:271347"
ORIGIN      

gataatgttaactaattacagggaagagtcgtgcaatgggctttgctgtcagagatttgccctggaaccaatagtaatttgctgtttttttttccaccccgaatcttcgcccaatcagagatagagattgctgtaggcatgaacaagcaggatatggctgatgaagccctctttttgcttctgcacaatgaggttatatcctgtgtgtataaagccggcggtgaccagggggatgcggaaaatggaaagtgtattactaaactggagaacatgggatttcgtgttggacaaggtttaatagagcgatttaccaaggacacagccaggttcaaagatgaactagatataatgaaatttgtctgcaaagatttttggacaacggtgtttaagaagcaaattgataatctccggaccaatcatcagggcatttatgtgcttcaggataataaattccgacttattacccagatgtctgcaggaaaacagtatctggaacatgcaccaaagtacctggcattttcttgtggtttaatcagaggaggtttgtctaacttgggaataaagagtattgtcacagcagaagtctcagtcatgcctgcatgcaaattccaggtgatgattcaaaagctgtagcaaaggagtgaagtctgagggggcagtgttaaaaaacgaaatgtattgtacaaatcactgtgtgtcatacattaaggagccagtctgatatttatgtatttatttttatttggatgttcaccacctaactgacattcccatttatttatgtaaaggtttcttgtatactttggttatgactttatcatcagaacaggtttttctctgaattgcccagttaggcaccactaaagcacactaaagtatcttacaggaaaatggatatactaaaactgacattatgccagcctcacatgagcagattatggctatatgacctgcagccagaacagctagatctctgagcagtttggccatacagcagtagggcccagctagcctcagatccgtgtcataggcagactaactgccaatattggattgtgtatgaccagcttggttttcttggaagtgtacataactggttaacaggggagttatgcctctagacatgttaggaacagatctcttttaaacattgtaaaataccttagaatatatgtttattaagtaaaatgtaagcagctattggctgaagacagatataaatttactaatacaattaaaattatttccactaaaaaaagtaaactgaatttcaaacctattctaataaataccaccattctaaaataagaaactgggacaaattaagtaacaaccaactattcccagttatgcccagacatgccccaacccatgaaaacccttgccaacattctggtaaataaatatctttaggactttcctatctatatagggacaattgcagttaatgtttttattattggtattggtctgtaatttaaaaaggggagttgaatgaatttgtataagaaagcagcatatatatatagtttggcagaaagtattcctacagtaggttgagtaaaatacgggattgggggacatttaaaagagaactaaaccctaaaaaat

//