GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-15 16:22:02, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001100226            1076 bp    mRNA    linear   VRT 03-DEC-2023
DEFINITION  Xenopus tropicalis SIX homeobox 6 (six6), mRNA.
ACCESSION   NM_001100226
VERSION     NM_001100226.1
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 1076)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev Dyn 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC135852.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC135852.1, BX728378.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00028293, SAMD00028294
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1076
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="8"
                     /map="8"
     gene            1..1076
                     /gene="six6"
                     /gene_synonym="hpe2; mcopct2; optx2; six3.2; Six6.1;
                     Six6.2; six9; XOptx2; XSix3; xSix6; XSix6.1; xsix6.2"
                     /note="SIX homeobox 6"
                     /db_xref="GeneID:100101705"
                     /db_xref="Xenbase:XB-GENE-483146"
     exon            1..679
                     /gene="six6"
                     /gene_synonym="hpe2; mcopct2; optx2; six3.2; Six6.1;
                     Six6.2; six9; XOptx2; XSix3; xSix6; XSix6.1; xsix6.2"
                     /inference="alignment:Splign:2.1.0"
     CDS             108..842
                     /gene="six6"
                     /gene_synonym="hpe2; mcopct2; optx2; six3.2; Six6.1;
                     Six6.2; six9; XOptx2; XSix3; xSix6; XSix6.1; xsix6.2"
                     /note="sine oculis homeobox homolog 6; optic six gene 2"
                     /codon_start=1
                     /product="homeobox protein SIX6"
                     /protein_id="NP_001093696.1"
                     /db_xref="GeneID:100101705"
                     /db_xref="Xenbase:XB-GENE-483146"
                     /translation="
MFQLPILNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNFRELYHILENHKFTKDSYTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGTGHSLGPDERGEPLGSASSPAASLSSKAATSAISITSSDSECDI"
     misc_feature    132..473
                     /gene="six6"
                     /gene_synonym="hpe2; mcopct2; optx2; six3.2; Six6.1;
                     Six6.2; six9; XOptx2; XSix3; xSix6; XSix6.1; xsix6.2"
                     /note="Transcriptional regulator, SIX1, N-terminal SD
                     domain; Region: SIX1_SD; pfam16878"
                     /db_xref="CDD:465293"
     misc_feature    495..641
                     /gene="six6"
                     /gene_synonym="hpe2; mcopct2; optx2; six3.2; Six6.1;
                     Six6.2; six9; XOptx2; XSix3; xSix6; XSix6.1; xsix6.2"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(498..500,507..509,627..629,636..641)
                     /gene="six6"
                     /gene_synonym="hpe2; mcopct2; optx2; six3.2; Six6.1;
                     Six6.2; six9; XOptx2; XSix3; xSix6; XSix6.1; xsix6.2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            680..1076
                     /gene="six6"
                     /gene_synonym="hpe2; mcopct2; optx2; six3.2; Six6.1;
                     Six6.2; six9; XOptx2; XSix3; xSix6; XSix6.1; xsix6.2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcgagtgcagccagagatcatcttcaagtaggtcgagctcacatcttgtcatctttttatgcggagtcgacgttcgaaaagctgatttggcaacaaaatcagagtcaatgtttcagctgcctattctgaacttcagcccccagcaggtagctggggtgtgtgagaccctagaagagagtggggacattgagcgccttggtcgctttctgtggtcattgccagtagctcctgcagcctgtgaggcacttaataaaaatgagtctgtcctccgagctagggctattgtggcctttcatacggggaacttcagggaactctaccacattctggaaaatcacaaatttaccaaggactcgtacaccaagctgcaggctctgtggctggaggcgcattaccaagaagcagagaagctaagggggagacctttggggccagtagataagtacagagtgagaaagaagttccctctccccagaactatttgggacggggaacagaagactcactgctttaaagaacgaacgaggcatttgcttagggaatggtacctacaagatccctatccaaatcccagcaaaaaaagggaactcgcccaagcgactggacttaccccaacacaagtagggaactggttcaaaaaccggagacaaagagacagagcagcggcggctaagaacaggctgcagcagcaagtcttgtcccagggaactggccattcattgggtccggatgagagaggagaaccgctgggctcagcctccagtcctgcagcaagtctgtccagcaaagcggccacctctgccatctccatcacatccagcgacagtgaatgtgacatctgacccatgggcacacttagcgcagcacaaactcacaacacagtgcctgactaagcgttacagcctgggccacaggaccattaacaggccgtctcagtaccagggttcgcttatcacattggcatttctgactactgatctgcctgcaattcacaatagaagactgtaaggtttgtcacacttaatctggggacctactaatccaatgcctcgattgcctactctccaagtgtctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]