LOCUS       NM_001016826            2070 bp    mRNA    linear   VRT 03-APR-2024
DEFINITION  Xenopus tropicalis UBA domain containing 1 (ubac1), mRNA.
ACCESSION   NM_001016826
VERSION     NM_001016826.2
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 2070)
  AUTHORS   Gaudet,P., Livstone,M.S., Lewis,S.E. and Thomas,P.D.
  TITLE     Phylogenetic-based propagation of functional annotations within the
            Gene Ontology consortium
  JOURNAL   Brief Bioinform 12 (5), 449-462 (2011)
   PUBMED   21873635
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CR855524.2.
            
            On Oct 14, 2005 this sequence version replaced NM_001016826.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CR855524.2 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00861988, SAMN00861989
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2070
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="8"
                     /map="8"
     gene            1..2070
                     /gene="ubac1"
                     /gene_synonym="kpc2; ubadc1"
                     /note="UBA domain containing 1"
                     /db_xref="GeneID:549580"
                     /db_xref="Xenbase:XB-GENE-997434"
     CDS             36..1256
                     /gene="ubac1"
                     /gene_synonym="kpc2; ubadc1"
                     /note="ubiquitin associated domain containing 1; UBA
                     domain-containing protein 1; E3 ubiquitin-protein ligase
                     subunit KPC2; kip1 ubiquitination-promoting complex
                     protein 2"
                     /codon_start=1
                     /product="ubiquitin-associated domain-containing protein
                     1"
                     /protein_id="NP_001016826.1"
                     /db_xref="GeneID:549580"
                     /db_xref="Xenbase:XB-GENE-997434"
                     /translation="

MFVQEEKIFAGKGLRLHICSLDGAEWLEEVTEEITVEKLKEKCLKHCSHGSLEDPKSLTHHKLVHASSERVLSDTKTLAEENLQDNDVLLLVKKRAPPPTPKMAEVSADEKRKQDQKAPDKDAILKATAGLPARSTDRTVAQHNMRDFQTELRKILVSLIEVAQKLLALNPDAIELFKKANAMLDEDDEDRVDEVALRQLTEMGFPESRAVKALRLNHMSVTQAMEWLIEHADDPAADAPLPCENSSEAAGGLATGEAETKPTLGAGAEDPKDELTEIFKKIRRKREFRPDPRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDRKPSPEDLDKGIDTTSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT"

     misc_feature    60..320
                     /gene="ubac1"
                     /gene_synonym="kpc2; ubadc1"
                     /note="first ubiquitin-like (Ubl) domain located at the
                     N-terminus of coronavirus SARS-CoV non-structural protein
                     3 (Nsp3) and related proteins; Region:
                     Ubl1_cv_Nsp3_N-like; cl28922"
                     /db_xref="CDD:475130"
     misc_feature    318..401
                     /gene="ubac1"
                     /gene_synonym="kpc2; ubadc1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q28DG7.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    621..731
                     /gene="ubac1"
                     /gene_synonym="kpc2; ubadc1"
                     /note="UBA1 domain found in Kip1 ubiquitination-promoting
                     complex protein 2 (KPC2) and similar proteins; Region:
                     UBA1_KPC2; cd14303"
                     /db_xref="CDD:270488"
     misc_feature    747..851
                     /gene="ubac1"
                     /gene_synonym="kpc2; ubadc1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q28DG7.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    903..1019
                     /gene="ubac1"
                     /gene_synonym="kpc2; ubadc1"
                     /note="UBA2 domain found in Kip1 ubiquitination-promoting
                     complex protein 2 (KPC2) and similar proteins; Region:
                     UBA2_KPC2; cd14304"
                     /db_xref="CDD:270489"
     misc_feature    1095..1214
                     /gene="ubac1"
                     /gene_synonym="kpc2; ubadc1"
                     /note="Heat shock chaperonin-binding motif; Region: STI1;
                     smart00727"
                     /db_xref="CDD:128966"
ORIGIN      

atgcccttggctcggtaggtagcggggagcgggacatgttcgtgcaggaggagaagatctttgcggggaaggggctccggctgcacatctgctccctggatggggccgagtggctggaggaggtcacggaggagatcacggtggagaagctgaaggagaagtgcctgaagcactgttcccacgggagcctggaggatccaaaaagcttaacccatcacaagctggtccatgcctcctctgagcgggttctctccgacaccaagacgctagcggaggagaatctccaagacaacgatgtcctcctgttggttaaaaaaagggcaccgccgccaacaccaaagatggccgaagtctctgctgacgagaagcggaagcaggatcagaaagcgccagacaaagacgccattctcaaggcaacggccggccttccagcccgcagcacggaccgcacggtggcgcaacataacatgagagacttccagactgagctcaggaagatactggtgtccctcattgaagttgcccagaagctgctggcgctgaaccctgatgcgattgagctgttcaagaaagccaatgccatgctggatgaggatgacgaggatcgggtagatgaagtcgcactgcggcagctgacggagatgggattcccggagagccgagccgtgaaagccctccgcttaaatcacatgtcggtgacgcaggccatggagtggttgatcgaacacgccgacgaccccgccgccgacgcgcctctcccatgtgagaattcctctgaggccgccgggggtttggccacgggggaagcggagacgaagccaactctgggggccggcgccgaggaccctaaggatgaactcacagaaatattcaagaaaattcgcaggaaaagagaattccgcccagaccctcgagccgtcattgcattaatggagatgggcttcgatgaaaaagaagtcattgatgcgctgcgagtgaacaacaaccaacaagacgccgcttgtgagtggctattgggtgacaggaagccatcgccggaggacttggacaaggggatcgatacgactagcccgttattccaagccattctggacaaccctgtagtacagctaggcctcactaaccccaaaactctgttagcttttgaagatatgctcgaaaacccgttaaacagcacccagtggatgaacgacccggagacgggccccgtgatgcttcagatctctagaattttccaaaccttaaaccgcacgtaggacacgtctcgtttttttttttcgtttacgccaacaccaacgagcttattgcctcttggacttttgggggaactcgaatatgacgggcaggtcggataccaaaatcccgcccccgtttaaggaggggccctaacccaaagtcaccttacaagaatatcaagggatatagattggcctaaaaccgcattgctgtttaaagggaaagtaaaacctgttttcggatactatttatgtgaatgaattgctttttttttttttctttttttgtgtgaatttcctttaggttggatggcactgaaatgtatttagggttaatagcagtgtgatttttcttttttgctttactaaaaccgcgctggacaagaccaccaaaatcgacttaaggtggtacagcaaccccccagcatgttgtgagcaagctgccggcttatgggtttgttaggaataggccccgtggcaacgtaaaaccagaatcagttatttattctaccgattttatatggttttaacccccagcgatgaataataagattttagttggccgcgctcccgccgggaacggcagattcttaatatttttagtttttatttggattattttgccgggacacattcaggaaaggttctattggggaaggcggcgtatgaatccgttctccttccttaccaatgcacaagtaccgagttcttcctcagaaagaaactttttacattctgcaactgcgccgaccttggtatggctactcccaagtgttctccctatgcgtgttacatggaaataaaacctctttatgcaaaaaaaaaaaaaaaaaaa

//