GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-15 16:15:35, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001016678            1610 bp    mRNA    linear   VRT 01-FEB-2024
DEFINITION  Xenopus tropicalis homeobox D1 (hoxd1), mRNA.
ACCESSION   NM_001016678
VERSION     NM_001016678.2
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 1610)
  AUTHORS   Klein,S.L., Strausberg,R.L., Wagner,L., Pontius,J., Clifton,S.W.
            and Richardson,P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev Dyn 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CR760220.2.
            
            On Oct 14, 2005 this sequence version replaced NM_001016678.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CR760220.2, BC160395.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00028290, SAMD00028291
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1610
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="9"
                     /map="9"
     gene            1..1610
                     /gene="hoxd1"
                     /gene_synonym="hox-4.7; hox4; hox4g; Xhox.lab; xhox.lab1;
                     xhoxd1; xlab; Xlab-1"
                     /note="homeobox D1"
                     /db_xref="GeneID:549432"
                     /db_xref="Xenbase:XB-GENE-482731"
     exon            1..631
                     /gene="hoxd1"
                     /gene_synonym="hox-4.7; hox4; hox4g; Xhox.lab; xhox.lab1;
                     xhoxd1; xlab; Xlab-1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    7..9
                     /gene="hoxd1"
                     /gene_synonym="hox-4.7; hox4; hox4g; Xhox.lab; xhox.lab1;
                     xhoxd1; xlab; Xlab-1"
                     /note="upstream in-frame stop codon"
     CDS             58..963
                     /gene="hoxd1"
                     /gene_synonym="hox-4.7; hox4; hox4g; Xhox.lab; xhox.lab1;
                     xhoxd1; xlab; Xlab-1"
                     /note="homeo box D1"
                     /codon_start=1
                     /product="homeobox protein Hox-D1"
                     /protein_id="NP_001016678.1"
                     /db_xref="GeneID:549432"
                     /db_xref="Xenbase:XB-GENE-482731"
                     /translation="
MNSYLEYTSCGDVVAFSPKFCRSDQRNMTLQPYPGSGADHPFMPVGGVPGSVAHQASHQSPALYAPCSLDVAYEPPPPSDYSFLHSSTDYDYYGSNHLVEETGGHIPYGSSVFPGNGSYILNGQLSYRTLGEETQMAQIAQCKEPLEVYPGGNLQSISPSPGTYPKPASPASDTHVSTFDWMKVKRNPPKKSLQSEYGVASPPCTVRTNFTTKQLTELEKEFHFNKYLTRARRIEIANSLQLNDTQVKIWFQNRRMKQKKREREGSLPNSPPSGPASSICVKTPLSKSVHETATLSPSKDV"
     misc_feature    589..606
                     /gene="hoxd1"
                     /gene_synonym="hox-4.7; hox4; hox4g; Xhox.lab; xhox.lab1;
                     xhoxd1; xlab; Xlab-1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q28IU6.1);
                     Region: Antp-type hexapeptide. /evidence=ECO:0000255"
     misc_feature    676..837
                     /gene="hoxd1"
                     /gene_synonym="hox-4.7; hox4; hox4g; Xhox.lab; xhox.lab1;
                     xhoxd1; xlab; Xlab-1"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    820..960
                     /gene="hoxd1"
                     /gene_synonym="hox-4.7; hox4; hox4g; Xhox.lab; xhox.lab1;
                     xhoxd1; xlab; Xlab-1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q28IU6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            632..1592
                     /gene="hoxd1"
                     /gene_synonym="hox-4.7; hox4; hox4g; Xhox.lab; xhox.lab1;
                     xhoxd1; xlab; Xlab-1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aaagattgagggatcatcaggttcctcagctgtccggccggagaagtctccctagagatgaattcctacctagaatacacttcttgcggggatgttgtagccttttcacccaagttctgccgcagcgaccaaagaaacatgaccttgcagccttaccctggcagtggagcagatcatccctttatgccagttggaggtgtgcctggctccgttgcccaccaggcttctcaccagtctccagcactttatgctccatgcagcctagatgtcgcttatgagccacccccaccttctgattacagtttcttacatagcagcaccgattacgactattatggatctaatcacttggtagaagagactgggggccacattccctatggcagttctgtattcccagggaatggatcgtacatcctcaatgggcagctgagctacaggactcttggagaagaaacccaaatggctcaaatcgcccaatgtaaggaaccactagaagtttatcctgggggcaacttgcagagtatctccccttcgcctggcacttacccaaaacctgcctccccggcgtctgacacccatgtcagcacgtttgattggatgaaagttaaaaggaacccacctaagaaaagtttacaatctgaatatggggtagcaagtcccccctgcaccgtgaggacaaacttcaccaccaaacaactgactgaactcgaaaaggagtttcattttaacaagtatctcaccagggcaagacgcatcgaaatcgcaaactccctccaactcaacgatactcaggttaagatctggttccagaataggcgaatgaaacaaaagaaaagggaaagggaggggtctttgcccaattctcccccgtccggaccagcatccagtatctgcgtaaaaactccactttcaaagtctgtacatgaaactgcgacgctgtcgccatccaaggacgtttaagtataaagactcacagctagagaccaaatatatgcgatcgtctcggaacagagttaacaacacgatgcattctgctgcaccccaagcaggcacaaactagggtgactttgcactatattccgttacttgtgttacctataaattgtacagtatgtattgtatatacagaccttagcagctcaatcctgcatctatgcattaaatacatatatagggtctaggttgtttgtagagagaacagcatgaagggtggagattcacaagtactactcacatatacctttatataatcatggttaagtatgtaagattacacatgccatgcatgtgcgacagaaaaagcaagtcctgcagccagatactgtacatactgtataaagccagtactgacattaccaaagatggataggagtctgccatttcctcaactttatcgactgaatttgcactattgtgttttgctgttccctgggtctcaagcaatttcttctgaaactgactgaactcattctgggacgtattgtagtacatcaggaagctatgacctgaaggcgaattttataaaattttactgctgtatatatctatttttttataaactaataaaaataaaaatcaaattgactatgaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]