LOCUS       NM_018445               1250 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens VCP-interacting membrane protein (VIMP), transcript
            variant 2, mRNA.
ACCESSION   NM_018445
VERSION     NM_018445.4  GI:45439347
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1250)
  AUTHORS   Christensen,L.C., Jensen,N.W., Vala,A., Kamarauskaite,J.,
            Johansson,L., Winther,J.R., Hofmann,K., Teilum,K. and Ellgaard,L.
  TITLE     The human selenoprotein VCP-interacting membrane protein (VIMP) is
            non-globular and harbors a reductase function in an intrinsically
            disordered region
  JOURNAL   J. Biol. Chem. 287 (31), 26388-26399 (2012)
   PUBMED   22700979
  REMARK    GeneRIF: the redox properties observed for recombinant VIMP are
            compatible with a function as a reductase
REFERENCE   2  (bases 1 to 1250)
  AUTHORS   Fradejas,N., Serrano-Perez Mdel,C., Tranque,P. and Calvo,S.
  TITLE     Selenoprotein S expression in reactive astrocytes following brain
            injury
  JOURNAL   Glia 59 (6), 959-972 (2011)
   PUBMED   21456042
  REMARK    GeneRIF: Upregulation of SelS expression in reactive astrocytes
            reveals a new protective role for SelS against inflammation and
            endoplasmic reticulum stress that can be relevant to astrocyte
            function.
REFERENCE   3  (bases 1 to 1250)
  AUTHORS   Olsson,M., Olsson,B., Jacobson,P., Thelle,D.S., Bjorkegren,J.,
            Walley,A., Froguel,P., Carlsson,L.M. and Sjoholm,K.
  TITLE     Expression of the selenoprotein S (SELS) gene in subcutaneous
            adipose tissue and SELS genotype are associated with metabolic risk
            factors
  JOURNAL   Metab. Clin. Exp. 60 (1), 114-120 (2011)
   PUBMED   20619427
  REMARK    GeneRIF: a role for SELS in the development of metabolic disease,
            especially in the context of insulin resistance.
            GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 1250)
  AUTHORS   Sutherland,A., Kim,D.H., Relton,C., Ahn,Y.O. and Hesketh,J.
  TITLE     Polymorphisms in the selenoprotein S and 15-kDa selenoprotein genes
            are associated with altered susceptibility to colorectal cancer
  JOURNAL   Genes Nutr 5 (3), 215-223 (2010)
   PUBMED   21052528
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   5  (bases 1 to 1250)
  AUTHORS   Meplan,C., Hughes,D.J., Pardini,B., Naccarati,A., Soucek,P.,
            Vodickova,L., Hlavata,I., Vrana,D., Vodicka,P. and Hesketh,J.E.
  TITLE     Genetic variants in selenoprotein genes increase risk of colorectal
            cancer
  JOURNAL   Carcinogenesis 31 (6), 1074-1079 (2010)
   PUBMED   20378690
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   6  (bases 1 to 1250)
  AUTHORS   Gao,Y., Feng,H.C., Walder,K., Bolton,K., Sunderland,T., Bishara,N.,
            Quick,M., Kantham,L. and Collier,G.R.
  TITLE     Regulation of the selenoprotein SelS by glucose deprivation and
            endoplasmic reticulum stress - SelS is a novel glucose-regulated
            protein
  JOURNAL   FEBS Lett. 563 (1-3), 185-190 (2004)
   PUBMED   15063746
  REMARK    GeneRIF: SELS is regulated by glucose deprivation and endoplasmic
            reticulum stress.  It is a glucose-regulated protein.
REFERENCE   7  (bases 1 to 1250)
  AUTHORS   Kryukov,G.V., Castellano,S., Novoselov,S.V., Lobanov,A.V.,
            Zehtab,O., Guigo,R. and Gladyshev,V.N.
  TITLE     Characterization of mammalian selenoproteomes
  JOURNAL   Science 300 (5624), 1439-1443 (2003)
   PUBMED   12775843
REFERENCE   8  (bases 1 to 1250)
  AUTHORS   Gao,Y., Walder,K., Sunderland,T., Kantham,L., Feng,H.C., Quick,M.,
            Bishara,N., de Silva,A., Augert,G., Tenne-Brown,J. and Collier,G.R.
  TITLE     Elevation in Tanis expression alters glucose metabolism and insulin
            sensitivity in H4IIE cells
  JOURNAL   Diabetes 52 (4), 929-934 (2003)
   PUBMED   12663463
REFERENCE   9  (bases 1 to 1250)
  AUTHORS   Walder,K., Kantham,L., McMillan,J.S., Trevaskis,J., Kerr,L., De
            Silva,A., Sunderland,T., Godde,N., Gao,Y., Bishara,N., Windmill,K.,
            Tenne-Brown,J., Augert,G., Zimmet,P.Z. and Collier,G.R.
  TITLE     Tanis: a link between type 2 diabetes and inflammation?
  JOURNAL   Diabetes 51 (6), 1859-1866 (2002)
   PUBMED   12031974
REFERENCE   10 (bases 1 to 1250)
  AUTHORS   Hu,R.M., Han,Z.G., Song,H.D., Peng,Y.D., Huang,Q.H., Ren,S.X.,
            Gu,Y.J., Huang,C.H., Li,Y.B., Jiang,C.L., Fu,G., Zhang,Q.H.,
            Gu,B.W., Dai,M., Mao,Y.F., Gao,G.F., Rong,R., Ye,M., Zhou,J.,
            Xu,S.H., Gu,J., Shi,J.X., Jin,W.R., Zhang,C.K., Wu,T.M.,
            Huang,G.Y., Chen,Z., Chen,M.D. and Chen,J.L.
  TITLE     Gene expression profiling in the human
            hypothalamus-pituitary-adrenal axis and full-length cDNA cloning
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 97 (17), 9543-9548 (2000)
   PUBMED   10931946
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BG829960.1, BC005840.2,
            BQ014190.1 and BI494034.1.
            On Mar 15, 2004 this sequence version replaced gi:42734439.
            
            Summary: This gene encodes a selenoprotein, which contains a
            selenocysteine (Sec) residue at its active site. The selenocysteine
            is encoded by the UGA codon that normally signals translation
            termination. The 3' UTR of selenoprotein genes have a common
            stem-loop structure, the sec insertion sequence (SECIS), that is
            necessary for the recognition of UGA as a Sec codon rather than as
            a stop signal. Studies suggest that this protein may regulate
            cytokine production, and thus play a key role in the control of the
            inflammatory response. Two alternatively spliced transcript
            variants encoding the same protein have been found for this gene.
            [provided by RefSeq, Jul 2008].
            
            Transcript Variant: This variant (2) has a different 3' UTR
            compared to variant 1. Transcript variants 1 and 2 encode the same
            protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BG723489.1, AK026455.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            protein contains selenocysteine :: PMID: 12775843
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-52                BG829960.1         26-77
            53-1224             BC005840.2         1-1172
            1225-1231           BQ014190.1         17-23               c
            1232-1250           BI494034.1         1-19                c
FEATURES             Location/Qualifiers
     source          1..1250
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q26.3"
     gene            1..1250
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /note="VCP-interacting membrane protein"
                     /db_xref="GeneID:55829"
                     /db_xref="HGNC:30396"
                     /db_xref="MIM:607918"
     exon            1..154
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    10..12
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /note="upstream in-frame stop codon"
     CDS             79..648
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /codon_start=1
                     /transl_except=(pos:640..642,aa:Sec)
                     /product="selenoprotein S"
                     /protein_id="NP_060915.2"
                     /db_xref="GI:33285002"
                     /db_xref="CCDS:CCDS53979.1"
                     /db_xref="GeneID:55829"
                     /db_xref="HGNC:30396"
                     /db_xref="MIM:607918"
                     /translation="

MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

"
     misc_feature    85..606
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:148511"
     misc_feature    160..222
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9BQE4.3);
                     transmembrane region"
     misc_feature    496..498
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9BQE4.3); phosphorylation site"
     misc_feature    640..642
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /note="Selenocysteine; other site"
     exon            155..289
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /inference="alignment:Splign:1.39.8"
     exon            290..396
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /inference="alignment:Splign:1.39.8"
     exon            397..486
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /inference="alignment:Splign:1.39.8"
     exon            487..562
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /inference="alignment:Splign:1.39.8"
     variation       496
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200236506"
     exon            563..1234
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /inference="alignment:Splign:1.39.8"
     STS             960..1082
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /standard_name="RH46969"
                     /db_xref="UniSTS:6952"
     polyA_site      1144
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     polyA_signal    1203..1208
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
     polyA_site      1224
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     polyA_site      1231
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     polyA_site      1234
                     /gene="VIMP"
                     /gene_synonym="AD-015; ADO15; SBBI8; SELS; SEPS1"
ORIGIN      

acgtgtgcgtaggagcgcaccggaagcgcccggctggaggcgcggcggcagggctgggcggcggcggcggcggcggtcatggaacgccaagaggagtctctgtccgcgcggccggccctggagaccgaggggctgcgcttcctgcacaccacggtgggctccctgctggccacctatggctggtacatcgtcttcagctgcatccttctctacgtggtctttcagaagctttccgcccggctaagagccttgaggcagaggcagctggaccgagctgcggctgctgtggaacctgatgttgttgttaaacgacaagaagctttagcagctgctcgactgaaaatgcaagaagaactaaatgcgcaagttgaaaagcataaggaaaaactgaaacaacttgaagaagaaaaaaggagacagaagattgaaatgtgggacagcatgcaagaaggaaaaagttacaaaggaaatgcaaagaagccccaggaggaagacagtcctgggccttccacttcatctgtcctgaaacggaaatcggacagaaagcctttgcggggaggaggttataacccgttgtctggtgaaggaggcggagcttgctcctggagacctggacgcagaggcccgtcatctggcggatgaggctaagaatcttgttagtgtcacttttgacattagcaagatgaacccttaaccctcgattcaattgccttacgcacgcttttcacagtgactagccaaggggaggtggggttgatttctgttcctaactacacctgcatatgtcagggctccagtcagcaaaaggtatagatgttgcctctaggcatgaggtcattggtcacattctacttggagacagtgattgcattcattgatttcatggttaattgctagttggtaggtaaaggcctctagatgattagcaatcttgataaaagaggcctagtaatgttcttttgaggttagaaatccttgctgctaggacagtctctgtgacaggttgcgttgaatgatgtcttccttatcaatggtgagcccaccagtgaggattactgatgtggacagttgatggggtttgtttctgtatatttatttttatgtacagaactttgtaaaaacgaaactatttaaaaaacaagaataacatttttagcatctttattcaaggagatttatggacttcaatttgtctatcaaacattaaatagctttttattacaacctctaactaaaaaaaaaaaaaaaaa

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:55829 -> Molecular function: GO:0004872 [receptor activity] evidence: NAS
            GeneID:55829 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:55829 -> Molecular function: GO:0008430 [selenium binding] evidence: IEA
            GeneID:55829 -> Molecular function: GO:0016209 [antioxidant activity] evidence: IDA
            GeneID:55829 -> Molecular function: GO:0019899 [enzyme binding] evidence: IPI
            GeneID:55829 -> Biological process: GO:0002865 [negative regulation of acute inflammatory response to antigenic stimulus] evidence: IMP
            GeneID:55829 -> Biological process: GO:0006111 [regulation of gluconeogenesis] evidence: TAS
            GeneID:55829 -> Biological process: GO:0006983 [ER overload response] evidence: IDA
            GeneID:55829 -> Biological process: GO:0006983 [ER overload response] evidence: IMP
            GeneID:55829 -> Biological process: GO:0009749 [response to glucose stimulus] evidence: IEP
            GeneID:55829 -> Biological process: GO:0030433 [ER-associated protein catabolic process] evidence: IDA
            GeneID:55829 -> Biological process: GO:0030968 [endoplasmic reticulum unfolded protein response] evidence: IDA
            GeneID:55829 -> Biological process: GO:0030970 [retrograde protein transport, ER to cytosol] evidence: IDA
            GeneID:55829 -> Biological process: GO:0032715 [negative regulation of interleukin-6 production] evidence: ISS
            GeneID:55829 -> Biological process: GO:0032720 [negative regulation of tumor necrosis factor production] evidence: ISS
            GeneID:55829 -> Biological process: GO:0032869 [cellular response to insulin stimulus] evidence: TAS
            GeneID:55829 -> Biological process: GO:0034599 [cellular response to oxidative stress] evidence: IMP
            GeneID:55829 -> Biological process: GO:0045184 [establishment of protein localization] evidence: TAS
            GeneID:55829 -> Biological process: GO:0045454 [cell redox homeostasis] evidence: IDA
            GeneID:55829 -> Biological process: GO:0045719 [negative regulation of glycogen biosynthetic process] evidence: TAS
            GeneID:55829 -> Biological process: GO:0046325 [negative regulation of glucose import] evidence: TAS
            GeneID:55829 -> Biological process: GO:0050728 [negative regulation of inflammatory response] evidence: IC
            GeneID:55829 -> Biological process: GO:0051771 [negative regulation of nitric-oxide synthase biosynthetic process] evidence: IMP
            GeneID:55829 -> Biological process: GO:0051775 [response to redox state] evidence: IDA
            GeneID:55829 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IMP
            GeneID:55829 -> Biological process: GO:0080164 [regulation of nitric oxide metabolic process] evidence: IMP
            GeneID:55829 -> Biological process: GO:1902236 [negative regulation of intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress] evidence: IMP
            GeneID:55829 -> Biological process: GO:2000110 [negative regulation of macrophage apoptotic process] evidence: IMP
            GeneID:55829 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IDA
            GeneID:55829 -> Cellular component: GO:0005881 [cytoplasmic microtubule] evidence: IDA
            GeneID:55829 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
            GeneID:55829 -> Cellular component: GO:0030176 [integral to endoplasmic reticulum membrane] evidence: IDA
            GeneID:55829 -> Cellular component: GO:0034361 [very-low-density lipoprotein particle] evidence: IDA
            GeneID:55829 -> Cellular component: GO:0034362 [low-density lipoprotein particle] evidence: IDA