2024-04-27 13:39:38, GGRNA : RefSeq release 60 (20130726)
LOCUS XM_003960947 1755 bp mRNA linear PRI 30-OCT-2012 DEFINITION PREDICTED: Homo sapiens double homeobox 4 like 3 (DUX4L3), mRNA. ACCESSION XM_003960947 VERSION XM_003960947.1 GI:410170229 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_001839741) annotated using gene prediction method: GNOMON. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Homo sapiens Annotation Release 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1755 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="Unknown" /sex="male" /dev_stage="adult" gene 1..1755 /gene="DUX4L3" /note="Derived by automated computational analysis using gene prediction method: GNOMON. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:653548" /db_xref="HGNC:38688" CDS 1..1755 /gene="DUX4L3" /codon_start=1 /transl_except=(pos:961..963,aa:OTHER) /transl_except=(pos:1501..1503,aa:OTHER) /transl_except=(pos:1606..1608,aa:OTHER) /product="LOW QUALITY PROTEIN: double homeobox 4 like 3" /protein_id="XP_003960996.1" /db_xref="GI:410170230" /db_xref="GeneID:653548" /db_xref="HGNC:38688" /translation="
MQGRVEVQHGAFALLASFQTGHTADSPCCRTRESIVRPSRWGGISSLGSRSGLLRGNERDPPACVCETVPAMTTPTGTASFTEPRRPGTLPGSGRLSQVSPPFIKGWSLPACGSLXKSRWLAFRAGLLVAPTSLHMSAEVHGSPPASLCPCPSVKFWPVLPAKALPKPSDGTLPAEARGRGWRRRLVWTPSQSKDLRACFERNSYPGIAARERLAQAIGIPETSVQIWFQNWRSRQLRQQRRESRPWPWRRGPQEGRRKLTAVTRSQTPLLLQAFEKDHFPGIAAREALARETGLPVSRIQIRFQNRRARHQGQAGRAPTXAGCLCNAAPVGCHPAPSWVAFAHTGAWGTGLPAPQVSCAPGALPQGAFVSQASRAVLVLQPSQATPAEGISQPASPCWDFAYAAPGLPEEALSHPQAPRWPLRPDKSWEDGDPQCVSLPGPCTVGQPWPAQAGPQGQGVLAPPVSQVSPWWGWGRGPEVIGVAWEPQAGTAPPPTPAPPXASTGQGQMQGIVAPSQAFQEPGHSSALPSGLLLGXLLASQEFLQQAQTFPETESPGELEALKEAASLEAPLSEEEYRALLEEL
" misc_feature 544..693 /gene="DUX4L3" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(544..558,562..564,613..615,631..633,670..672, 676..681,688..693) /gene="DUX4L3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(550..552,559..561,679..681,688..693) /gene="DUX4L3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" misc_feature 769..918 /gene="DUX4L3" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(769..783,787..789,838..840,856..858,895..897, 901..906,913..918) /gene="DUX4L3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(775..777,784..786,904..906,913..918) /gene="DUX4L3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" ORIGIN
atgcagggaagggtggaagtccagcatggtgcctttgctctccttgccagtttccaaaccggccacactgcagactccccatgttgccgcacacgggaatccatcgtcaggccatcacgctggggaggcatctcctctctggggtctcgctctggtctcctacgtggaaatgaacgagatccacccgcctgcgtgtgtgagactgtcccggcaatgacgacacccacaggcactgcctccttcacggagcctcgacgccctgggacccttccggggtcgggcaggctgtcccaggtctcaccgccattcatcaaggggtggagcctgcctgcctgtgggtctttanntaagagccgctggctggctttccgggcaggcctcctggttgcacctacctcattgcacatgtcggctgaggtgcacgggagcccgccagcctctctctgcccgtgtccgtccgtgaaattctggccggtgctccccgcgaaggccctcccgaaaccttcagacggcactctccccgcggaagcccggggacggggatggcgaaggagactcgtttggaccccgagccaaagcaaggacctgcgagcctgctttgagcggaactcgtatccaggcatcgccgccagagaacggctggcccaggccatcggcattccggagaccagtgtccagatttggtttcagaattggaggtcacgccagctgaggcagcaacggcgggaatctcggccctggccctggagacgcggcccgcaagaaggcaggcgaaagctgacagccgtcaccagatcacagacacccctgctgctccaagcctttgagaaggatcactttccaggcatcgccgccagggaagcgctggccagagagacaggcctcccggtttccaggattcagatccggtttcagaatcgaagggccaggcaccagggacaggctggcagggcgcccacctaggcagggtgcctgtgcaacgcagcccccgtcgggtgtcaccctgctccctcttgggtcgccttcgcccacactggcgcgtggggaacggggcttcccgcaccccaggtgtcctgcgcgcctggggctctcccacagggggctttcgtgagccaggcatcgagggctgtcctcgtgctccagccaagccaggccacgccggcagaggggatctcccaacctgcctcgccatgctgggattttgcctatgctgccccaggtcttcctgaagaggcgctctcccaccctcaggctcctcggtggcctctgcgcccagacaaaagctgggaggacggtgacccgcagtgcgtcagcctgccgggcccttgcacggtgggacagccttggcccgctcaagcggggccacagggccaaggtgtgcttgcgcctcccgtgtcccaggtgagtccgtggtggggctggggccggggtcccgaggtcatcggggtggcgtgggaaccccaagccggaacagctccacctcccacgcccgcgcccccataggcctccacggggcaggggcagatgcaaggcatcgtggcgccctcccaggcattccaggagccggggcactcgtctgcactcccctccggcctgctactgggttagctcttggcgagccaggagtttctgcagcaggcgcaaactttcccagaaacggagtcccctggggagctggaggccttgaaagaggccgcctcactggaagcacccctcagcgaggaagaataccgggctctgctggaggagctttaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:653548 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA GeneID:653548 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:653548 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:653548 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.