2024-04-20 16:55:18, GGRNA : RefSeq release 60 (20130726)
LOCUS XM_003960846 1419 bp mRNA linear PRI 30-OCT-2012 DEFINITION PREDICTED: Homo sapiens double homeobox 4 like 2 (DUX4L2), mRNA. ACCESSION XM_003960846 VERSION XM_003960846.1 GI:410173867 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004078960) annotated using gene prediction method: GNOMON. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Homo sapiens Annotation Release 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1419 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="Unknown" /cell_line="CHM1htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..1419 /gene="DUX4L2" /note="Derived by automated computational analysis using gene prediction method: GNOMON. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:728410" /db_xref="HGNC:37267" CDS 1..1419 /gene="DUX4L2" /codon_start=1 /transl_except=(pos:229..231,aa:OTHER) /transl_except=(pos:637..639,aa:OTHER) /transl_except=(pos:1384..1386,aa:OTHER) /product="LOW QUALITY PROTEIN: double homeobox 4 like 2" /protein_id="XP_003960895.1" /db_xref="GI:410173868" /db_xref="GeneID:728410" /db_xref="HGNC:37267" /translation="
MKWWSLPACGPLKNRWLAVREGLLAAHSSVHRPAEVHGSPPTSLCPCPSVKFWPGLPVMALPILPDSTLPAEARGRXRQRRLVWTPSQSEAQQACFERNPYPGMATRERLAQSIGIPEPWVQIWFQNERSCHLRQHRRESQLWPGRRCLQEGRQKRTAITGSQTALLRALEKDRFAGIAAREELARETGLLESRIQIWFQNRRARHPCRQAAXPSQAGSLCNTAPGRCHPAPSCGALAHTGAWRTRLXAPHVPCTPGALPQGVFLSQGAKAVPVLQPSQAXPAEGISQPYPERGDIAYAALAPPEGALSHPQAPQWPPHLGKTKENRDLQCDALPGPCAVGQPGPLXVLAPPVSQGSPWWVWGRGPQVAXGGWDPQAEAAPPRLPVPPEASVWQGQMLGIPAASQALQEPGRSSALPSGLLLDELLARAEFLQQAQTFLETEAPGDLEDFEEAASLEAPRSXEEYRALLEEL
" misc_feature 232..408 /gene="DUX4L2" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(232..246,250..252,301..303,319..321,358..360, 364..369,376..381,385..393,397..402) /gene="DUX4L2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(238..240,247..249,367..369,376..381,388..390) /gene="DUX4L2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" misc_feature 457..618 /gene="DUX4L2" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(457..471,475..477,523..525,541..543,580..582, 586..591,598..603,607..615) /gene="DUX4L2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(463..465,472..474,589..591,598..603,610..612) /gene="DUX4L2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" ORIGIN
atgaagtggtggagcctgcctgcctgtgggcctttaaagaaccgctggctggctgtccgggaaggccttctggctgcacattcctcagtgcacaggccggctgaggtgcacgggagccctccgacctctctctgcccatgtccttccgtgaaattctggccggggctccccgtgatggccctcccgatacttccggacagcaccctccctgcagaagcccggggacggtgacggcaaaggagactcgtttggaccccgagccaaagtgaggcccagcaagcctgctttgagcggaacccatacccgggcatggccaccagagaacggctggcccagtccatcggcattccggagccttgggtccagatttggtttcagaatgagaggtcatgccacctgaggcagcaccggcgggaatctcagctctggccagggagacgctgcctgcaagaaggcaggcagaagcggactgccatcaccggatcccagaccgcccttctccgagccttggagaaggatcgctttgcaggcatcgctgccagggaagagctggccagagagacaggcctcctggagtccaggattcagatctggtttcagaatcgaagggccaggcacccttgcaggcaggcggcctaaccttcgcaggcaggcagcctgtgcaacacggcccccggcaggtgtcaccctgctccctcatgtggcgccctcgcacacactggcgcatggagaacgcggcttnctgcaccccacgtgccctgcacgcctggtgctctcccacagggggttttcttgagccagggagcaaaggccgtccccgtgctccagcccagccaggccnagccggctgaggggatctcccaaccttacccagaacgtggggatattgcctatgctgccctggctcctccagaaggggcgctatcccaccctcaggctcctcagtggcctccgcacctgggcaaaaccaaggagaaccgggacctgcagtgcgatgccctgccgggtccttgcgcggtgggacagcctggcccgctcnaagtgcttgcgccacctgtgtcccaggggagtccatggtgggtctggggccggggtccccaggtcgccntgggtgggtgggatccccaagccgaggcagctccacctcgcctgcccgtgcccccggaggcctccgtgtggcaggggcagatgctaggcatcccggcagcctcccaggcgctccaggagccggggcgttcttctgcactcccctccggcctgctgctggatgagctccttgcgagagcagagtttctgcagcaagcgcaaactttcctagaaacggaggccccgggggacctggaggacttcgaagaggccgcatcactggaagcaccccgcagctaggaggaataccgggctctgctggaggagctttag
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:728410 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA GeneID:728410 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:728410 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:728410 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.