2024-04-20 22:32:08, GGRNA : RefSeq release 60 (20130726)
LOCUS XM_003960843 1560 bp mRNA linear PRI 30-OCT-2012 DEFINITION PREDICTED: Homo sapiens double homeobox 4 like 7 (DUX4L7), mRNA. ACCESSION XM_003960843 VERSION XM_003960843.1 GI:410173861 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_004078508) annotated using gene prediction method: GNOMON. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Homo sapiens Annotation Release 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1560 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="Unknown" /cell_line="CHM1htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..1560 /gene="DUX4L7" /note="Derived by automated computational analysis using gene prediction method: GNOMON. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:653543" /db_xref="HGNC:37266" CDS 1..1560 /gene="DUX4L7" /codon_start=1 /transl_except=(pos:238..240,aa:OTHER) /transl_except=(pos:898..900,aa:OTHER) /product="LOW QUALITY PROTEIN: double homeobox 4 like 7" /protein_id="XP_003960892.1" /db_xref="GI:410173862" /db_xref="GeneID:653543" /db_xref="HGNC:37266" /translation="
MKWWSLPACGPLXKTRWLPVRVGLLAAPAAVHRPAEMHGIPPASLCPCPSKKFRPGLPVMALPTPSVSTLPVEAQGRGQXRRLVWTPSQSEALQACFQWNPYPGIATGEGLSLTINIPEPRVQIXVQNESSHQLRHHRWESRPWPGRHGPQEGRXKQTAVTGSQTTLLLRALEKDRFPGIIAKEELARETGVPESRSEIWIHNRRARHPGQAGWAPGQAGSLCNAAPRGCQPARSWVAFDHTGAWGKVLPAPHVTCVPGAHPQGAFMSHGARVVPVLQLSQAVPAEGISQPAPACGDFPXAAPAPPEGALSHPQAPRWPPHPGKSREDRDPQRDGLLGPCTVGHPGPAQVGPQGQGVLAPPASQGCPSWGWGWGPQVARAAWKPQAGASPPHQPAPPEDSVWQGQMQGIPATSQALQELGRSSALLSGQLLDELPASPEFLQQVQPFLEREAAGELEALEEAASLEAPLSEEEYRALLQDFRTRGLDGVRSGQGGGLSFAGKTWLAMEGHVFPPPSPLG
" misc_feature 241..411 /gene="DUX4L7" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(241..249,253..255,304..306,322..324,361..363, 367..372,379..384,388..396,400..405) /gene="DUX4L7" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(241..243,250..252,370..372,379..384,391..393) /gene="DUX4L7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" misc_feature 460..624 /gene="DUX4L7" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(460..474,478..480,529..531,547..549,586..588, 592..597,604..609,613..621) /gene="DUX4L7" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(466..468,475..477,595..597,604..609,616..618) /gene="DUX4L7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" ORIGIN
atgaagtggtggagcctgcctgcctgtgggcctttanntaagacccgctggctgcctgtccgggtaggcctcctggctgcacctgccgcagtgcacaggccggctgagatgcacgggatcccaccggcctctctctgcccgtgtccgtccaagaaattccggccggggctccccgtgatggccctcccgacaccttctgtcagcaccctccccgtggaagcccagggacggggacagtgaaggagactcgtttggaccccgagccaaagcgaggccctgcaagcctgctttcagtggaacccgtacccgggcatcgccaccggagaagggctgtccctgaccatcaacattccagagcccagggtccagattncggttcagaatgagagttcacaccagctgaggcaccaccggtgggaatctcggccctggcctgggagacacggcccgcaagaaggcaggncaaaacagactgccgtcaccggatcccagaccaccctgctcctccgagcccttgagaaggatcgctttccaggcatcatcgccaaggaagagctggccagagagacgggcgtcccggagtcccggagtgagatctggattcacaatcgaagggccaggcacccaggacaggctggctgggcgcctgggcaggcaggcagcctgtgcaacgcggccccccgtggatgtcaacctgctcgctcgtgggtcgccttcgaccacaccggcgcgtggggaaaggtgcttcccgcaccccacgttacttgtgtgcctggggctcacccacagggggctttcatgagccatggagcgagggtggtccccgtgctccagctcagccaggcagtgcctgctgaggggatctcccaacctgccccggcatgcggggattttccctaagctgccccggctcctccggaaggggcactctcccatcctcaggctcctcggtggcctccgcacccgggcaaaagccgggaggacagggacccgcagcgcgacggcctgctgggcccttgcacggtgggacatcctgggcccgctcaagtggggccgcagggccaaggtgtgcttgcgccacccgcttcccaggggtgtccgtcgtggggctggggctggggtccccaggtcgccagggcggcatggaaaccccaagctggggcatctccacctcaccagccagcgcccccggaggactccgtgtggcaggggcagatgcaaggcatcccggcgacatcccaggcactccaggagctgggccggtcgtctgcactcctgtccggccagctgctggatgagctcccggcgagcccggagtttctgcagcaggtgcaacctttccttgaaagggaggccgcgggggagttggaggccttggaagaggccgcgtcgctggaagcacccctcagcgaggaagaataccgggctctgctacaggactttaggacgcgaggtttggacggggtcaggtcggggcagggaggtggcctctctttcgcggggaaaacctggctggctatggaggggcatgtcttccccccaccctctccactgggctga
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:653543 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA GeneID:653543 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:653543 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:653543 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.