Home |
Help |
Advanced search
2024-04-20 01:26:55, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_199185 1362 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens nucleophosmin (nucleolar phosphoprotein B23, numatrin)
(NPM1), transcript variant 2, mRNA.
ACCESSION NM_199185
VERSION NM_199185.3 GI:262331548
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1362)
AUTHORS Zhu,H., Vishwamitra,D., Curry,C.V., Manshouri,R., Diao,L., Khan,A.
and Amin,H.M.
TITLE NPM-ALK up-regulates iNOS expression through a
STAT3/microRNA-26a-dependent mechanism
JOURNAL J. Pathol. 230 (1), 82-94 (2013)
PUBMED 23338972
REMARK GeneRIF: Our investigation of the mechanisms underlying the
decrease in miR-26a in this lymphoma revealed novel evidence that
STAT3, a major downstream substrate of NPM-ALK tyrosine kinase
activity, suppresses MIR26A1 gene expression.
REFERENCE 2 (bases 1 to 1362)
AUTHORS Sportoletti,P., Varasano,E., Rossi,R., Bereshchenko,O.,
Cecchini,D., Gionfriddo,I., Bolli,N., Tiacci,E., Intermesoli,T.,
Zanghi,P., Masciulli,A., Martelli,M.P., Falzetti,F., Martelli,M.F.
and Falini,B.
TITLE The human NPM1 mutation A perturbs megakaryopoiesis in a
conditional mouse model
JOURNAL Blood 121 (17), 3447-3458 (2013)
PUBMED 23435463
REMARK GeneRIF: NPM1 mutation perturbs megakaryopoiesis and is associated
with acute myeloid leukemia.
REFERENCE 3 (bases 1 to 1362)
AUTHORS Pratcorona M, Brunet S, Nomdedeu J, Ribera JM, Tormo M, Duarte R,
Escoda L, Guardia R, Queipo de Llano MP, Salamero O, Bargay J,
Pedro C, Marti JM, Torrebadell M, Diaz-Beya M, Camos M, Colomer D,
Hoyos M, Sierra J and Esteve J.
CONSRTM Grupo Cooperativo Para el Estudio y Tratamiento de las Leucemias
Agudas Mieloblasticas
TITLE Favorable outcome of patients with acute myeloid leukemia harboring
a low-allelic burden FLT3-ITD mutation and concomitant NPM1
mutation: relevance to post-remission therapy
JOURNAL Blood 121 (14), 2734-2738 (2013)
PUBMED 23377436
REMARK GeneRIF: Effect of FLT3 burden is modulated by NPM1 mutation,
especially in patients with a low ratio.
REFERENCE 4 (bases 1 to 1362)
AUTHORS Yatsenko,Y., Kalennik,O., Maschan,M., Kalinina,I., Maschan,A. and
Nasedkina,T.
TITLE NPM1, FLT3, and c-KIT mutations in pediatric acute myeloid leukemia
in Russian population
JOURNAL J. Pediatr. Hematol. Oncol. 35 (3), E100-E108 (2013)
PUBMED 23511494
REMARK GeneRIF: NPM1 mutations are associated with better complete
remission in pediatric acute myeloid leukemia.
REFERENCE 5 (bases 1 to 1362)
AUTHORS Ando,K., Tsushima,H., Matsuo,E., Horio,K., Tominaga-Sato,S.,
Imanishi,D., Imaizumi,Y., Iwanaga,M., Itonaga,H., Yoshida,S.,
Hata,T., Moriuchi,R., Kiyoi,H., Nimer,S., Mano,H., Naoe,T.,
Tomonaga,M. and Miyazaki,Y.
TITLE Mutations in the nucleolar phosphoprotein, nucleophosmin, promote
the expression of the oncogenic transcription factor MEF/ELF4 in
leukemia cells and potentiates transformation
JOURNAL J. Biol. Chem. 288 (13), 9457-9467 (2013)
PUBMED 23393136
REMARK GeneRIF: enhanced HDM2 expression induced by mutant NPM1 may have a
role in MEF/ELF4-dependent leukemogenesis
REFERENCE 6 (bases 1 to 1362)
AUTHORS Fankhauser,C., Izaurralde,E., Adachi,Y., Wingfield,P. and
Laemmli,U.K.
TITLE Specific complex of human immunodeficiency virus type 1 rev and
nucleolar B23 proteins: dissociation by the Rev response element
JOURNAL Mol. Cell. Biol. 11 (5), 2567-2575 (1991)
PUBMED 2017166
REFERENCE 7 (bases 1 to 1362)
AUTHORS Venkatesh,L.K., Mohammed,S. and Chinnadurai,G.
TITLE Functional domains of the HIV-1 rev gene required for
trans-regulation and subcellular localization
JOURNAL Virology 176 (1), 39-47 (1990)
PUBMED 2109912
REFERENCE 8 (bases 1 to 1362)
AUTHORS Cochrane,A.W., Perkins,A. and Rosen,C.A.
TITLE Identification of sequences important in the nucleolar localization
of human immunodeficiency virus Rev: relevance of nucleolar
localization to function
JOURNAL J. Virol. 64 (2), 881-885 (1990)
PUBMED 2404140
REFERENCE 9 (bases 1 to 1362)
AUTHORS Zhang,X.X., Thomis,D.C. and Samuel,C.E.
TITLE Isolation and characterization of a molecular cDNA clone of a human
mRNA from interferon-treated cells encoding nucleolar protein B23,
numatrin
JOURNAL Biochem. Biophys. Res. Commun. 164 (1), 176-184 (1989)
PUBMED 2478125
REFERENCE 10 (bases 1 to 1362)
AUTHORS Chan,P.K., Chan,W.Y., Yung,B.Y., Cook,R.G., Aldrich,M.B., Ku,D.,
Goldknopf,I.L. and Busch,H.
TITLE Amino acid sequence of a specific antigenic peptide of protein B23
JOURNAL J. Biol. Chem. 261 (30), 14335-14341 (1986)
PUBMED 2429957
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff in
collaboration with Francesco Amaldi. The reference sequence was
derived from AC091980.4, BC009623.2 and AC093246.3.
On Nov 3, 2009 this sequence version replaced gi:83641867.
Summary: This gene encodes a phosphoprotein which moves between the
nucleus and the cytoplasm. The gene product is thought to be
involved in several processes including regulation of the ARF/p53
pathway. A number of genes are fusion partners have been
characterized, in particular the anaplastic lymphoma kinase gene on
chromosome 2. Mutations in this gene are associated with acute
myeloid leukemia. More than a dozen pseudogenes of this gene have
been identified. Alternative splicing results in multiple
transcript variants.[provided by RefSeq, Nov 2009].
Transcript Variant: This variant (2) lacks an alternate in-frame
exon, compared to variant 1, resulting in a shorter protein
(isoform 2) that lacks an internal segment, compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC009623.2, AL537010.3 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-153 AC091980.4 138097-138249
154-1207 BC009623.2 35-1088
1208-1208 AC093246.3 84342-84342 c
1209-1362 BC009623.2 1089-1242
FEATURES Location/Qualifiers
source 1..1362
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="5"
/map="5q35.1"
gene 1..1362
/gene="NPM1"
/gene_synonym="B23; NPM"
/note="nucleophosmin (nucleolar phosphoprotein B23,
numatrin)"
/db_xref="GeneID:4869"
/db_xref="HGNC:7910"
/db_xref="HPRD:01246"
/db_xref="MIM:164040"
exon 1..303
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 49
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:75828148"
variation 127
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="c"
/db_xref="dbSNP:374925391"
variation 138
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:10069429"
variation 142
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:148722569"
variation 147
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:112023099"
variation 149
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="g"
/replace="t"
/db_xref="dbSNP:112330400"
variation 152
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:377340416"
variation 170..171
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:11551528"
variation 171
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:28411385"
variation 182
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:180887715"
variation 183..184
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:11551579"
variation 183
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:185295288"
variation 190
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:189577643"
variation 192
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:111426800"
variation 197
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551555"
variation 198
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551547"
variation 203
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:375152584"
variation 204
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551556"
variation 210
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:200132495"
variation 218
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:202010899"
variation 221
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551523"
variation 225
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:35747006"
variation 232
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551571"
variation 242
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:370439209"
variation 243
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:368504792"
CDS 246..1043
/gene="NPM1"
/gene_synonym="B23; NPM"
/note="isoform 2 is encoded by transcript variant 2;
nucleophosmin/nucleoplasmin family, member 1; nucleolar
protein NO38"
/codon_start=1
/product="nucleophosmin isoform 2"
/protein_id="NP_954654.1"
/db_xref="GI:40353734"
/db_xref="CCDS:CCDS4377.1"
/db_xref="GeneID:4869"
/db_xref="HGNC:7910"
/db_xref="HPRD:01246"
/db_xref="MIM:164040"
/translation="
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
"
misc_feature 255..257
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03652"
misc_feature 273..275
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 282..>593
/gene="NPM1"
/gene_synonym="B23; NPM"
/note="Nucleoplasmin; Region: Nucleoplasmin; pfam03066"
/db_xref="CDD:145949"
misc_feature 444..446
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 453..455
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 453..455
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 528..530
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 618..620
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 618..620
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 858..860
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:00302"
misc_feature 867..869
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:00302"
misc_feature 918..920
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 918..920
/gene="NPM1"
/gene_synonym="B23; NPM"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
variation 251
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:373962671"
variation 257
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:368150213"
variation 284
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:142254256"
exon 304..383
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 312
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:35979859"
exon 384..503
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 400
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:372208958"
variation 422
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="g"
/replace="t"
/db_xref="dbSNP:142102985"
variation 436
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551526"
variation 438
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:11551576"
variation 446
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:200294440"
variation 479
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551522"
variation 481
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:11551525"
variation 483
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:17851944"
variation 502
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:147806769"
exon 504..597
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 512..513
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="g"
/replace="t"
/db_xref="dbSNP:11551553"
variation 566
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:201813873"
variation 596
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:141086340"
exon 598..704
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 626
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:200558908"
variation 673
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:375558588"
exon 705..769
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 719
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:61749648"
variation 740
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:146936311"
variation 743
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:147629377"
variation 767
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:368269652"
exon 770..827
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 778
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:17856513"
variation 785
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:140888436"
variation 788
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:61755048"
variation 815
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:368568545"
variation 823
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:183724988"
exon 828..929
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 865
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="c"
/db_xref="dbSNP:374517078"
variation 882
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:138586088"
variation 891
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:143209617"
variation 904
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:377348662"
variation 920
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="t"
/db_xref="dbSNP:11551532"
exon 930..1004
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 935
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:371199566"
variation 970
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:17851431"
variation 971
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:373846371"
variation 980
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:149305908"
exon 1005..1362
/gene="NPM1"
/gene_synonym="B23; NPM"
/inference="alignment:Splign:1.39.8"
variation 1006
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:371956477"
variation 1017
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:17850940"
variation 1054
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="t"
/db_xref="dbSNP:201083444"
variation 1060
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:376359773"
variation 1066
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="t"
/db_xref="dbSNP:3209214"
variation 1072
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:200638434"
variation 1079
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:1059404"
variation 1132
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:6859650"
variation 1171
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="c"
/db_xref="dbSNP:183613332"
variation 1177
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:146200852"
variation 1208
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace=""
/replace="t"
/db_xref="dbSNP:34351976"
variation 1290
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="a"
/replace="g"
/db_xref="dbSNP:1059683"
variation 1317
/gene="NPM1"
/gene_synonym="B23; NPM"
/replace="c"
/replace="g"
/db_xref="dbSNP:139047811"
polyA_signal 1336..1341
/gene="NPM1"
/gene_synonym="B23; NPM"
polyA_site 1362
/gene="NPM1"
/gene_synonym="B23; NPM"
ORIGIN
agaaaggagtggggttgaaaagcgcttgcgcaggacggctacggtacgggggtgggagggcttcggagcacgcgcgcggaggcgggacttgggaagcgctcgcgagatcttcagggtctatatataagcgcggggagcctgcgtcctttccctggtgtgattccgtcctgcgcggttgttctctggagcagcgttcttttatctccgtccgccttctctcctacctaagtgcgtgccgccacccgatggaagattcgatggacatggacatgagccccctgaggccccagaactatcttttcggttgtgaactaaaggccgacaaagattatcactttaaggtggataatgatgaaaatgagcaccagttatctttaagaacggtcagtttaggggctggtgcaaaggatgagttgcacattgttgaagcagaggcaatgaattacgaaggcagtccaattaaagtaacactggcaactttgaaaatgtctgtacagccaacggtttcccttgggggctttgaaataacaccaccagtggtcttaaggttgaagtgtggttcagggccagtgcatattagtggacagcacttagtagctgtggaggaagatgcagagtcagaagatgaagaggaggaggatgtgaaactcttaagtatatctggaaagcggtctgcccctggaggtggtagcaaggttccacagaaaaaagtaaaacttgctgctgatgaagatgatgacgatgatgatgaagaggatgatgatgaagatgatgatgatgatgattttgatgatgaggaagctgaagaaaaagcgccagtgaagaaaggacaagaatccttcaagaaacaggaaaaaactcctaaaacaccaaaaggacctagttctgtagaagacattaaagcaaaaatgcaagcaagtatagaaaaaggtggttctcttcccaaagtggaagccaaattcatcaattatgtgaagaattgcttccggatgactgaccaagaggctattcaagatctctggcagtggaggaagtctctttaagaaaatagtttaaacaatttgttaaaaaattttccgtcttatttcatttctgtaacagttgatatctggctgtcctttttataatgcagagtgagaactttccctaccgtgtttgataaatgttgtccaggttctattgccaagaatgtgttgtccaaaatgcctgtttagtttttaaagatggaactccaccctttgcttggttttaagtatgtatggaatgttatgataggacatagtagtagcggtggtcagacatggaaatggtggggagacaaaaatatacatgtgaaataaaactcagtattttaataaagta
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:4869 -> Molecular function: GO:0003713 [transcription coactivator activity] evidence: IDA
GeneID:4869 -> Molecular function: GO:0003723 [RNA binding] evidence: IDA
GeneID:4869 -> Molecular function: GO:0004860 [protein kinase inhibitor activity] evidence: IDA
GeneID:4869 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:4869 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:4869 -> Molecular function: GO:0030957 [Tat protein binding] evidence: IDA
GeneID:4869 -> Molecular function: GO:0042393 [histone binding] evidence: IDA
GeneID:4869 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
GeneID:4869 -> Molecular function: GO:0043023 [ribosomal large subunit binding] evidence: IDA
GeneID:4869 -> Molecular function: GO:0043024 [ribosomal small subunit binding] evidence: IDA
GeneID:4869 -> Molecular function: GO:0046982 [protein heterodimerization activity] evidence: IMP
GeneID:4869 -> Molecular function: GO:0051059 [NF-kappaB binding] evidence: IDA
GeneID:4869 -> Molecular function: GO:0051059 [NF-kappaB binding] evidence: ISS
GeneID:4869 -> Molecular function: GO:0051082 [unfolded protein binding] evidence: IDA
GeneID:4869 -> Molecular function: GO:0051082 [unfolded protein binding] evidence: ISS
GeneID:4869 -> Biological process: GO:0006281 [DNA repair] evidence: IDA
GeneID:4869 -> Biological process: GO:0006334 [nucleosome assembly] evidence: IDA
GeneID:4869 -> Biological process: GO:0006334 [nucleosome assembly] evidence: TAS
GeneID:4869 -> Biological process: GO:0006886 [intracellular protein transport] evidence: TAS
GeneID:4869 -> Biological process: GO:0006913 [nucleocytoplasmic transport] evidence: IDA
GeneID:4869 -> Biological process: GO:0006913 [nucleocytoplasmic transport] evidence: TAS
GeneID:4869 -> Biological process: GO:0006950 [response to stress] evidence: IMP
GeneID:4869 -> Biological process: GO:0007098 [centrosome cycle] evidence: IMP
GeneID:4869 -> Biological process: GO:0007098 [centrosome cycle] evidence: ISS
GeneID:4869 -> Biological process: GO:0007165 [signal transduction] evidence: NAS
GeneID:4869 -> Biological process: GO:0007569 [cell aging] evidence: IMP
GeneID:4869 -> Biological process: GO:0007569 [cell aging] evidence: ISS
GeneID:4869 -> Biological process: GO:0008104 [protein localization] evidence: IDA
GeneID:4869 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IMP
GeneID:4869 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: ISS
GeneID:4869 -> Biological process: GO:0010826 [negative regulation of centrosome duplication] evidence: IMP
GeneID:4869 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:4869 -> Biological process: GO:0019048 [modulation by virus of host morphology or physiology] evidence: IEA
GeneID:4869 -> Biological process: GO:0032071 [regulation of endodeoxyribonuclease activity] evidence: IDA
GeneID:4869 -> Biological process: GO:0034080 [CENP-A containing nucleosome assembly at centromere] evidence: TAS
GeneID:4869 -> Biological process: GO:0042255 [ribosome assembly] evidence: TAS
GeneID:4869 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
GeneID:4869 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: NAS
GeneID:4869 -> Biological process: GO:0044387 [negative regulation of protein kinase activity by regulation of protein phosphorylation] evidence: IDA
GeneID:4869 -> Biological process: GO:0045727 [positive regulation of translation] evidence: IDA
GeneID:4869 -> Biological process: GO:0046599 [regulation of centriole replication] evidence: IMP
GeneID:4869 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: IMP
GeneID:4869 -> Biological process: GO:0051259 [protein oligomerization] evidence: IDA
GeneID:4869 -> Biological process: GO:0060699 [regulation of endoribonuclease activity] evidence: IDA
GeneID:4869 -> Biological process: GO:0060735 [regulation of eIF2 alpha phosphorylation by dsRNA] evidence: IDA
GeneID:4869 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:4869 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
GeneID:4869 -> Cellular component: GO:0005654 [nucleoplasm] evidence: IDA
GeneID:4869 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:4869 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:4869 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:4869 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS
GeneID:4869 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
GeneID:4869 -> Cellular component: GO:0005813 [centrosome] evidence: ISS
GeneID:4869 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:4869 -> Cellular component: GO:0030529 [ribonucleoprotein complex] evidence: IDA
GeneID:4869 -> Cellular component: GO:0031616 [spindle pole centrosome] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.