Home |
Help |
Advanced search
2024-04-19 19:31:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_182916 2291 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens tRNA nucleotidyl transferase, CCA-adding, 1 (TRNT1),
mRNA.
ACCESSION NM_182916
VERSION NM_182916.2 GI:155030239
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2291)
AUTHORS Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M.,
Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D.,
Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J.
TITLE Genetic variants in nuclear-encoded mitochondrial genes influence
AIDS progression
JOURNAL PLoS ONE 5 (9), E12862 (2010)
PUBMED 20877624
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 2291)
AUTHORS Nureki,O.
TITLE [Dynamic mechanism of CCA-adding polymerization reaction]
JOURNAL Seikagaku 80 (5), 429-434 (2008)
PUBMED 18575231
REMARK GeneRIF: is a RNA polymerase which newly adds CCA sequence to tRNA
3'terminal. This reaction was named as Vice-Anchored Knock-in and
Lock Dynamics.[review]
Review article
REFERENCE 3 (bases 1 to 2291)
AUTHORS Lizano,E., Schuster,J., Muller,M., Kelso,J. and Morl,M.
TITLE A splice variant of the human CCA-adding enzyme with modified
activity
JOURNAL J. Mol. Biol. 366 (4), 1258-1265 (2007)
PUBMED 17204286
REMARK GeneRIF: These findings strongly suggest that the splice variant of
the human CCA-adding enzyme is expressed in the cell although the
in vivo function remains unclear.
REFERENCE 4 (bases 1 to 2291)
AUTHORS Augustin,M.A., Reichert,A.S., Betat,H., Huber,R., Morl,M. and
Steegborn,C.
TITLE Crystal structure of the human CCA-adding enzyme: insights into
template-independent polymerization
JOURNAL J. Mol. Biol. 328 (5), 985-994 (2003)
PUBMED 12729736
REMARK GeneRIF: The crystal structure reveals a four domain architecture
with a cluster of conserved residues forming a positively charged
cleft between the first two domains.
REFERENCE 5 (bases 1 to 2291)
AUTHORS Nagaike,T., Suzuki,T., Tomari,Y., Takemoto-Hori,C., Negayama,F.,
Watanabe,K. and Ueda,T.
TITLE Identification and characterization of mammalian mitochondrial tRNA
nucleotidyltransferases
JOURNAL J. Biol. Chem. 276 (43), 40041-40049 (2001)
PUBMED 11504732
REFERENCE 6 (bases 1 to 2291)
AUTHORS Reichert,A.S., Thurlow,D.L. and Morl,M.
TITLE A eubacterial origin for the human tRNA nucleotidyltransferase?
JOURNAL Biol. Chem. 382 (10), 1431-1438 (2001)
PUBMED 11727826
REMARK GeneRIF: human gene transcript CGI-47 (#AF151805) was cloned and
encodes a bona fide CCA-adding enzyme and not a poly(A) polymerase.
REFERENCE 7 (bases 1 to 2291)
AUTHORS Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and
Wiemann,S.
TITLE Systematic subcellular localization of novel proteins identified by
large-scale cDNA sequencing
JOURNAL EMBO Rep. 1 (3), 287-292 (2000)
PUBMED 11256614
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DB032432.1, AB063105.1, DA884423.1, AL834397.1, BQ722111.1 and
DB525237.1.
On Aug 10, 2007 this sequence version replaced gi:41281989.
Summary: The CCA-adding enzyme TRNT1 (EC 2.7.7.25) is an essential
enzyme that catalyzes the addition of the CCA terminus to the
3-prime end of tRNA precursors. This reaction is a fundamental
prerequisite for mature tRNAs to become aminoacylated and to
participate in protein biosynthesis (Lizano et al., 2007 [PubMed
17204286]).[supplied by OMIM, Aug 2009].
##Evidence-Data-START##
Transcript exon combination :: AK290411.1, AB063105.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025082, ERS025083 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: reported by MitoCarta
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-57 DB032432.1 1-57
58-1049 AB063105.1 1-992
1050-1432 DA884423.1 196-578
1433-2019 AL834397.1 1337-1923
2020-2022 BQ722111.1 849-851
2023-2273 DB525237.1 186-436
2274-2291 AL834397.1 2197-2214
FEATURES Location/Qualifiers
source 1..2291
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="3"
/map="3p25.1"
gene 1..2291
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/note="tRNA nucleotidyl transferase, CCA-adding, 1"
/db_xref="GeneID:51095"
/db_xref="HGNC:17341"
/db_xref="MIM:612907"
exon 1..75
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="alignment:Splign:1.39.8"
variation 27
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="c"
/db_xref="dbSNP:116700990"
variation 28
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="g"
/db_xref="dbSNP:190141803"
exon 76..250
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="alignment:Splign:1.39.8"
variation 80
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:112624983"
misc_feature 88..90
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/note="upstream in-frame stop codon"
CDS 103..1407
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/EC_number="2.7.7.72"
/note="mitochondrial CCA-adding
tRNA-nucleotidyltransferase; tRNA-nucleotidyltransferase
1, mitochondrial; mt CCA-adding enzyme; mt tRNA
CCA-diphosphorylase; mt tRNA adenylyltransferase; mt tRNA
CCA-pyrophosphorylase; mitochondrial tRNA nucleotidyl
transferase, CCA-adding"
/codon_start=1
/product="CCA tRNA nucleotidyltransferase 1,
mitochondrial"
/protein_id="NP_886552.2"
/db_xref="GI:155030240"
/db_xref="CCDS:CCDS2561.2"
/db_xref="GeneID:51095"
/db_xref="HGNC:17341"
/db_xref="MIM:612907"
/translation="
MLRCLYHWHRPVLNRRWSRLCLLKQYLFTMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT
"
transit_peptide 103..225
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="non-experimental evidence, no additional
details recorded"
/note="Mitochondrion (Potential); propagated from
UniProtKB/Swiss-Prot (Q96Q11.2)"
misc_feature 220..1401
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/note="tRNA nucleotidyltransferase/poly(A) polymerase
[Translation, ribosomal structure and biogenesis]; Region:
PcnB; COG0617"
/db_xref="CDD:30962"
mat_peptide 226..1404
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/product="CCA tRNA nucleotidyltransferase 1,
mitochondrial"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q96Q11.2)"
misc_feature 226..636
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/note="Nucleotidyltransferase (NT) domain of ClassII
CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398"
/db_xref="CDD:143388"
misc_feature order(289..294,301..306,331..333,337..339,424..426,
463..465,478..480,550..561,568..570)
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/note="active site"
/db_xref="CDD:143388"
misc_feature order(289..294,301..303,331..333,337..339,550..558,
568..570)
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/note="NTP binding site [chemical binding]; other site"
/db_xref="CDD:143388"
misc_feature order(331..333,337..339,463..465)
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/note="metal binding triad [ion binding]; metal-binding
site"
/db_xref="CDD:143388"
misc_feature 748..903
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/note="Probable RNA and SrmB- binding site of polymerase
A; Region: PolyA_pol_RNAbd; pfam12627"
/db_xref="CDD:204988"
misc_feature 1300..1302
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q96Q11.2); phosphorylation site"
misc_feature 1306..1308
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (Q96Q11.2); acetylation site"
variation 122
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:202044723"
variation 167
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:191706901"
variation 169
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="g"
/db_xref="dbSNP:183596892"
variation 170
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:334773"
variation 190
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:375274931"
variation 195
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:141005872"
variation 207
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:368274081"
variation 209
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:138682354"
variation 235
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:75033443"
variation 236
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:371075348"
exon 251..444
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="alignment:Splign:1.39.8"
variation 286
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:150902982"
variation 333
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:114362638"
variation 361
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:140935012"
variation 433
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:149263693"
variation 443
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:143278715"
exon 445..583
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="alignment:Splign:1.39.8"
variation 480
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:369781563"
variation 481
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:200459255"
variation 485
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:148398677"
variation 489
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:371348120"
variation 546
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:41399044"
variation 580
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:370551439"
exon 584..710
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="alignment:Splign:1.39.8"
variation 590
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:146717589"
variation 594
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:150215891"
variation 602
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:145784140"
variation 608
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:62228636"
variation 612
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:371733557"
variation 615
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:190423145"
exon 711..904
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="alignment:Splign:1.39.8"
variation 726
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:367981406"
variation 732
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:143629126"
variation 733
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="c"
/db_xref="dbSNP:372027157"
variation 744
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:376042943"
variation 769
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:376974085"
variation 770
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:370011798"
variation 784
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:372627156"
variation 799
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:377218988"
variation 801
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:201260728"
variation 821
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:200021901"
variation 845
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:146909954"
variation 846
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:201105941"
variation 859
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="c"
/db_xref="dbSNP:369118529"
variation 861
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:373038908"
variation 882
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:150433086"
variation 883
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="g"
/db_xref="dbSNP:116700675"
variation 889
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:201873697"
variation 902
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:113909075"
exon 905..1158
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="alignment:Splign:1.39.8"
variation 911
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="g"
/db_xref="dbSNP:187921784"
variation 931
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:370699359"
variation 950
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:201174442"
variation 964
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:147986219"
variation 988
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:374592904"
variation 1002
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="c"
/db_xref="dbSNP:376431679"
variation 1047
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:150742431"
variation 1050
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:1705805"
variation 1077
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:372604723"
variation 1115
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:377244808"
variation 1137
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:199673739"
variation 1149
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="c"
/db_xref="dbSNP:62228638"
exon 1159..2276
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/inference="alignment:Splign:1.39.8"
variation 1168
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:375726663"
variation 1200
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:368371043"
variation 1316
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:202017054"
variation 1336
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:372367989"
variation 1348
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:199931785"
variation 1376
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:146766859"
variation 1393
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:142642881"
variation 1394
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:150984011"
variation 1440
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:371830913"
variation 1459
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:115688744"
variation 1491
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="c"
/db_xref="dbSNP:370590725"
variation 1508
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:140435051"
variation 1510
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="c"
/db_xref="dbSNP:185263036"
variation 1656
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="g"
/db_xref="dbSNP:77554992"
variation 1687
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="a"
/db_xref="dbSNP:369264199"
variation 1692
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:187353748"
variation 1703
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:192546200"
variation 1741
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:147416562"
variation 1756
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:184877192"
variation 1775
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:78363013"
variation 1809
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:12107469"
variation 1817
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="g"
/db_xref="dbSNP:139714355"
variation 1847
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:79659648"
variation 1892
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:149959848"
variation 1895
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:145691293"
STS 1903..2032
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/standard_name="RH102607"
/db_xref="UniSTS:96941"
variation 1972
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:77346437"
variation 2020
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:711629"
variation 2057..2058
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="atta"
/db_xref="dbSNP:145143419"
variation 2058..2059
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="atta"
/db_xref="dbSNP:371945051"
variation 2059..2060
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="ttaa"
/db_xref="dbSNP:140769388"
variation 2069..2070
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="a"
/replace="atta"
/db_xref="dbSNP:55994366"
variation 2070
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:188468103"
variation 2071..2072
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="aat"
/db_xref="dbSNP:71301177"
variation 2072
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:373459766"
variation 2081..2082
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="aaac"
/db_xref="dbSNP:373974701"
variation 2127
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:148513565"
variation 2136..2137
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="atta"
/db_xref="dbSNP:368142879"
variation 2151
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="c"
/replace="t"
/db_xref="dbSNP:74407198"
variation 2165..2166
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="ctgt"
/db_xref="dbSNP:371355502"
polyA_signal 2190..2195
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
variation 2205..2206
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="tatt"
/db_xref="dbSNP:201166570"
variation 2210..2211
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="aagatttattctctaaaga"
/db_xref="dbSNP:138799543"
variation 2211
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:199628389"
variation 2212
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:200853200"
polyA_site 2213
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
variation 2215..2216
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="tattctctaaagatt"
/db_xref="dbSNP:141431257"
variation 2215
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:112473748"
variation 2216..2217
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="tatatattctctaaagatt"
/db_xref="dbSNP:72028037"
variation 2221
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="t"
/db_xref="dbSNP:200421735"
variation 2222
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="c"
/db_xref="dbSNP:200952425"
variation 2223..2228
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="aaagatttattctctaaag"
/db_xref="dbSNP:6147688"
variation 2223
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="g"
/replace="t"
/db_xref="dbSNP:201907513"
variation 2224..2225
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="aaagatttattctctaaag"
/replace="aaga"
/replace="aagatttattctctaaaga"
/db_xref="dbSNP:34338926"
variation 2229..2230
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="aagatttattctctaaaga"
/db_xref="dbSNP:72364197"
variation 2231..2232
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="attc"
/replace="attctctaaagaaagattt"
/replace="attctctaaagattt"
/db_xref="dbSNP:11273850"
variation 2232..2233
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace=""
/replace="attctctaaagaaagattt"
/db_xref="dbSNP:71799368"
variation 2232
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
/replace="a"
/replace="g"
/db_xref="dbSNP:370319131"
polyA_signal 2257..2262
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
polyA_site 2276
/gene="TRNT1"
/gene_synonym="CCA1; CGI-47; MtCCA"
ORIGIN
gttggtgacgtcaccgcgttcaccagcccggaagtgcgcgtggcggcggtggcggctgcggcaacagcggggccgatgtgtagttggtgactgcctctccagatgctgaggtgcctgtatcattggcacaggccagtgctgaaccgtaggtggagtaggctgtgccttctgaagcagtatctattcacaatgaagttgcagtctcccgaattccagtcacttttcacagaaggactgaagagtctgacagaattatttgtcaaagagaatcacgaattaagaatagcaggaggagcagtgagggatttattaaatggagtaaagcctcaggatatagattttgccaccactgctacccctactcaaatgaaggagatgtttcagtcggctgggattcggatgataaacaacagaggagaaaagcacggaacaattactgccaggcttcatgaagaaaattttgagattactacactacggattgatgtcaccactgatggaagacatgctgaggtagaatttacaactgactggcagaaagatgcggaacgcagagatctcactataaattctatgtttttaggttttgatggcactttatttgactactttaatggttatgaagatttaaaaaataagaaagttagatttgttggacatgctaaacagagaatacaagaggattatcttagaattttaagatacttcaggttttatgggagaattgtagacaaacctggtgaccatgatcctgagactttggaagcaattgcagaaaatgcaaaaggcttggctggaatatcaggagaaaggatttgggtggaactgaaaaaaattcttgttggtaaccatgtaaatcatttgattcaccttatctatgatcttgatgtggctccttatataggtttacctgctaatgcaagtttagaagaatttgacaaagtcagtaaaaatgttgatggtttttcaccaaagccagtgactcttttggcctcattattcaaagtacaagatgatgtcacaaaattggatttgaggttgaagatcgcaaaagaggagaaaaaccttggcttatttatagttaaaaataggaaagatttaattaaagcaacagatagttcagacccattgaaaccctatcaagacttcattatagattctagggaacctgatgcaactactcgtgtatgtgaactactgaagtaccaaggagagcactgtctcctaaaggaaatgcagcagtggtccattcctccatttcctgtaagtggccatgacatcagaaaagtgggcatttcttcaggaaaagaaattggggctctattacaacagttgcgagaacagtggaaaaaaagtggttaccaaatggaaaaagatgaacttctgagttacataaagaagacctaaaactgatggctactaaaaagcagagcatttctggtaagactaaattttctcccctccctcttaatgaggttttagagactacaccagaataaaagacagtttaggggacctctgtagaacaacaagggtcttattttgtgaattatatatttcaagaactaaacagagatccacctttctggatctgatttatatcactgaaatgtacagttcttttggaatagtttcacctgagaaaacatagttggctattatctatcttaacctgttcaggcttttaaaaaaaactgtttttgcatagggtagtactaagatcttaaaaagtggtaactgtcttgaagaaaaaacgtttattgtttgtttgcaattgaaataacagggttaccttaacaatgactgtctatgatgtgtcagttcttatctgaattccaaaataaacctgtgcttaaaaaagaaataattgaccaagtaagtttgcataaaatgtgaatactaaatgtgtccccagttgctggcattcatatgtacaggatttgttctagcaagctatgcttcagtatgtggttgatatttttctgtcacaatgatttctttatgcatgcagagcctggggaagtcatgggattaacttgagggtcactattgagcctattaattaattattgttttaataaaacaaacattggtattggaagataaatatgtttatgtggtatctgacaatgtgtattaggtgtcatatacaatggtaatatgcctgtctttaaagtgttattttattaattaaaaggatatggctattattatatattctctaaagatttgagtcctaaatgctttcatcaggtaaataaaatgtataatacaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:51095 -> Molecular function: GO:0000049 [tRNA binding] evidence: IDA
GeneID:51095 -> Molecular function: GO:0004810 [tRNA adenylyltransferase activity] evidence: IDA
GeneID:51095 -> Molecular function: GO:0005524 [ATP binding] evidence: TAS
GeneID:51095 -> Molecular function: GO:0009022 [tRNA nucleotidyltransferase activity] evidence: IEA
GeneID:51095 -> Molecular function: GO:0052927 [CTP:tRNA cytidylyltransferase activity] evidence: IEA
GeneID:51095 -> Molecular function: GO:0052928 [CTP:3'-cytidine-tRNA cytidylyltransferase activity] evidence: IEA
GeneID:51095 -> Molecular function: GO:0052929 [ATP:3'-cytidine-cytidine-tRNA adenylyltransferase activity] evidence: IEA
GeneID:51095 -> Biological process: GO:0001680 [tRNA 3'-terminal CCA addition] evidence: IEA
GeneID:51095 -> Biological process: GO:0006626 [protein targeting to mitochondrion] evidence: TAS
GeneID:51095 -> Biological process: GO:0042780 [tRNA 3'-end processing] evidence: IDA
GeneID:51095 -> Cellular component: GO:0005622 [intracellular] evidence: IDA
GeneID:51095 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:51095 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_886552 -> EC 2.7.7.72
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.