GGRNA Home | Help | Advanced search

2024-04-25 20:56:42, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_152390               1703 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens transmembrane protein 178A (TMEM178A), transcript
            variant 1, mRNA.
ACCESSION   NM_152390
VERSION     NM_152390.2  GI:269914177
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1703)
  AUTHORS   Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
            Gibbs,R.A. and Butte,N.F.
  TITLE     Novel genetic loci identified for the pathophysiology of childhood
            obesity in the Hispanic population
  JOURNAL   PLoS ONE 7 (12), E51954 (2012)
   PUBMED   23251661
REFERENCE   2  (bases 1 to 1703)
  AUTHORS   Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J.,
            Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B.,
            Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E.,
            Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S.,
            Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C.,
            Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V.,
            Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K.,
            Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z.,
            Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
  TITLE     The secreted protein discovery initiative (SPDI), a large-scale
            effort to identify novel human secreted and transmembrane proteins:
            a bioinformatics assessment
  JOURNAL   Genome Res. 13 (10), 2265-2270 (2003)
   PUBMED   12975309
  REMARK    Erratum:[Genome Res. 2003 Dec;13(12):2759]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DN993805.1, BC029530.1 and AC007246.3.
            On Nov 25, 2009 this sequence version replaced gi:22748834.
            
            Transcript Variant: This variant (1) represents the longest
            transcript and encodes the longest isoform (1).
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC029530.1, AK075440.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-58                DN993805.1         7-64
            59-398              BC029530.1         4-343
            399-399             AC007246.3         93957-93957         c
            400-1703            BC029530.1         345-1648
FEATURES             Location/Qualifiers
     source          1..1703
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p22.1"
     gene            1..1703
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /note="transmembrane protein 178A"
                     /db_xref="GeneID:130733"
                     /db_xref="HGNC:28517"
     exon            1..480
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /inference="alignment:Splign:1.39.8"
     variation       72
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:188192195"
     CDS             81..974
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /note="isoform 1 precursor is encoded by transcript
                     variant 1; transmembrane protein 178"
                     /codon_start=1
                     /product="transmembrane protein 178A isoform 1 precursor"
                     /protein_id="NP_689603.2"
                     /db_xref="GI:269914178"
                     /db_xref="CCDS:CCDS1804.1"
                     /db_xref="GeneID:130733"
                     /db_xref="HGNC:28517"
                     /translation="
MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRADPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKYHFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV
"
     sig_peptide     81..155
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Potential; propagated from UniProtKB/Swiss-Prot
                     (Q8NBL3.1)"
     mat_peptide     156..971
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /product="Transmembrane protein 178A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8NBL3.1)"
     misc_feature    <585..902
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /note="PMP-22/EMP/MP20/Claudin tight junction; Region:
                     Claudin_2; pfam13903"
                     /db_xref="CDD:206074"
     misc_feature    618..680
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8NBL3.1);
                     transmembrane region"
     misc_feature    705..767
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8NBL3.1);
                     transmembrane region"
     misc_feature    852..914
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8NBL3.1);
                     transmembrane region"
     variation       98
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373389562"
     variation       140
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201221199"
     variation       151
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369145931"
     variation       271
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200656944"
     variation       399
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:17852679"
     variation       404
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372463281"
     variation       461
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377194329"
     variation       470
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201650119"
     exon            481..594
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /inference="alignment:Splign:1.39.8"
     variation       488
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148502563"
     variation       490
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371811326"
     variation       500
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199576215"
     variation       515
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375151652"
     variation       538
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149903489"
     variation       590
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144202857"
     exon            595..732
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /inference="alignment:Splign:1.39.8"
     variation       632
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141844962"
     variation       638
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200218947"
     variation       650
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141065930"
     variation       658
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138807729"
     variation       704
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377174385"
     exon            733..1686
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /inference="alignment:Splign:1.39.8"
     variation       735
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201281373"
     variation       749
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200061855"
     variation       755
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370900847"
     variation       766
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199591656"
     variation       768
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141928270"
     variation       794
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372186330"
     variation       816
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376560766"
     variation       860
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199548184"
     variation       868
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147809327"
     variation       883
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141827016"
     variation       888
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185395702"
     variation       917
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190057123"
     variation       928
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146286536"
     variation       947
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142620766"
     variation       1002
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369677272"
     variation       1006
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142536971"
     variation       1018
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374437026"
     variation       1026
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201625949"
     variation       1034
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182711713"
     STS             1187..1420
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /standard_name="G65633"
                     /db_xref="UniSTS:225408"
     variation       1263
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146772305"
     variation       1266
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147946378"
     variation       1346
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186728692"
     variation       1376
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191570624"
     variation       1453
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183783693"
     variation       1463
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369724230"
     variation       1505..1506
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34580359"
     variation       1505
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:200054347"
     variation       1517
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75590688"
     variation       1519
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76892392"
     STS             1520..1669
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /standard_name="SGC31151"
                     /db_xref="UniSTS:21366"
     variation       1571
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141875764"
     variation       1617
                     /gene="TMEM178A"
                     /gene_synonym="TMEM178"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188720081"
ORIGIN      
gggcggagagctggggccaagtgcattgtgtctggcggcggcgcgcgagcccaccggcggctgcggcggggcgggaagccatggagccgcgggcgctcgtcacggcgctcagcctcggcctcagcctgtgctccctggggctgctcgtcacggccatcttcaccgaccactggtacgagaccgacccccggcgccacaaggagagctgcgagcgcagccgcgcgggcgccgaccccccggaccagaagaaccgcctgatgccgctgtcgcacctgccgctgcgggactcgcccccgctggggcgccggctgctcccgggcggcccggggcgcgccgaccccgagtcctggcgctcgctcctggggctcggcgggctggacgccgagtgcggccggcccctcttcgccacctactcgggcctctggaggaagtgctacttcctgggcatcgaccgggacatcgacaccctcatcctgaaaggtattgcgcagcgatgcacggccatcaagtaccacttttctcagcccatccgcttgcgaaacattccttttaatttaaccaagaccatacagcaagatgagtggcacctgcttcatttaagaagaatcactgctggcttcctcggcatggccgtagccgtccttctctgcggctgcattgtggccacagtcagtttcttctgggaggagagcttgacccagcacgtggctggactcctgttcctcatgacagggatattttgcaccatttccctctgtacttatgccgccagtatctcgtatgatttgaaccggctcccaaagctaatttatagcctgcctgctgatgtggaacatggttacagctggtccatcttttgcgcctggtgcagtttaggctttattgtggcagctggaggtctctgcatcgcttatccgtttattagccggaccaagattgcacagctaaagtctggcagagactccacggtatgactgtcctcactgggcctgtccacagtgcgagcgactcctgaggggaacagcgcggagttcaggagtccaagcacaaagcggtcttttacattccaacctgttgcctgccagccctttctggattactgatagaaaatcatgcaaaacctcccaacctttctaaggacaagactactgtggattcaagtgctttaatgactatttatgcgttgactgtgagaatagggagcagtgccatgggacatttctaggtgtagagaaagaagaaactgcaatggaaaaatttgtatgatttccatttatttcagaaagtttgtatgtaacaattacccgagagtcatttctacttgcaaaaggattcgtaacaaagcgagtataattttcttgtcattgtatcatgcttgttaaattttaatgcagcatcttcagaacttgtcctgatggtgtcttattgtgtcagcaccaaatatttgtgcattatttgtggacgttccttgtcacaggaagattcttcttctgttgccttattgtttttttttttttaagtctcttctctgtctttgtactggaatcgaaatcataagataaacagatcaaacgtgcttaagagctaactcgtgacactatgcagtattgtttgaagacctgttgttcaacctctgtctctttatgttaactggatttctgcattaaatgactgcccccttgttaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:130733 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.