2024-04-25 14:29:04, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_145805 1836 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens ISL LIM homeobox 2 (ISL2), mRNA. ACCESSION NM_145805 VERSION NM_145805.1 GI:21956640 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1836) AUTHORS Oshikawa,M., Tsutsui,C., Ikegami,T., Fuchida,Y., Matsubara,M., Toyama,S., Usami,R., Ohtoko,K. and Kato,S. TITLE Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method JOURNAL Invest. Ophthalmol. Vis. Sci. 52 (9), 6662-6670 (2011) PUBMED 21697133 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1836) AUTHORS Tsigankov,D. and Koulakov,A.A. TITLE Sperry versus Hebb: topographic mapping in Isl2/EphA3 mutant mice JOURNAL BMC Neurosci 11, 155 (2010) PUBMED 21190559 REMARK GeneRIF: Experiments in Isl2/EphA3 knock-in mice test the interactions between effects of molecular labels and correlated activity during the development of neural connectivity. Publication Status: Online-Only REFERENCE 3 (bases 1 to 1836) AUTHORS Li,Y., Zhang,Y., He,B., Wang,Y., Yuan,Z., Yuan,W., Liao,P., Deng,Y., Xiao,J., Zhu,C., Wang,Y., Wu,X. and Liu,M. TITLE Cloning and expression of a novel human gene, Isl-2, encoded a LIM-homeodomain protein JOURNAL Mol. Biol. Rep. 34 (1), 19-26 (2007) PUBMED 17091338 REMARK GeneRIF: The broad expression of Isl-2 gene in tissues during embryogenesis and adult development suggests that it may be involved in both differentiation and maintenance of these tissues and might play an important role. REFERENCE 4 (bases 1 to 1836) AUTHORS Beausoleil,S.A., Jedrychowski,M., Schwartz,D., Elias,J.E., Villen,J., Li,J., Cohn,M.A., Cantley,L.C. and Gygi,S.P. TITLE Large-scale characterization of HeLa cell nuclear phosphoproteins JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 (2004) PUBMED 15302935 REFERENCE 5 (bases 1 to 1836) AUTHORS Jurata,L.W., Pfaff,S.L. and Gill,G.N. TITLE The nuclear LIM domain interactor NLI mediates homo- and heterodimerization of LIM domain transcription factors JOURNAL J. Biol. Chem. 273 (6), 3152-3157 (1998) PUBMED 9452425 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC012136.1. ##Evidence-Data-START## Transcript exon combination :: BC012136.1, BC011967.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1836 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="15" /map="15q23" gene 1..1836 /gene="ISL2" /note="ISL LIM homeobox 2" /db_xref="GeneID:64843" /db_xref="HGNC:18524" /db_xref="HPRD:11053" /db_xref="MIM:609481" exon 1..136 /gene="ISL2" /inference="alignment:Splign:1.39.8" variation 22 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:2203821" CDS 79..1158 /gene="ISL2" /note="ISL2 transcription factor, LIM/homeodomain, (islet-2)" /codon_start=1 /product="insulin gene enhancer protein ISL-2" /protein_id="NP_665804.1" /db_xref="GI:21956641" /db_xref="CCDS:CCDS10290.1" /db_xref="GeneID:64843" /db_xref="HGNC:18524" /db_xref="HPRD:11053" /db_xref="MIM:609481" /translation="
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
" misc_feature 157..321 /gene="ISL2" /note="The first LIM domain of Isl, a member of LHX protein family; Region: LIM1_Isl; cd09366" /db_xref="CDD:188752" misc_feature order(157..159,166..168,223..225,232..234,241..243, 250..252,307..309,316..318) /gene="ISL2" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:188752" misc_feature 343..507 /gene="ISL2" /note="The second LIM domain of Isl2; Region: LIM2_Isl2; cd09471" /db_xref="CDD:188855" misc_feature order(343..345,352..354,409..411,418..420,427..429, 436..438,493..495,502..504) /gene="ISL2" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:188855" misc_feature 547..549 /gene="ISL2" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[4] misc_feature 655..828 /gene="ISL2" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(655..666,670..672,721..723,739..741,778..780, 784..789,796..801,805..813,817..822) /gene="ISL2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(658..660,667..669,787..789,796..801,808..810) /gene="ISL2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" misc_feature 892..981 /gene="ISL2" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q96A47.1); Region: LIM-binding domain (LID) (By similarity)" misc_feature 913..915 /gene="ISL2" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (Q96A47.1); phosphorylation site" variation 104 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:148510226" variation 123 /gene="ISL2" /replace="g" /replace="t" /db_xref="dbSNP:142844685" exon 137..326 /gene="ISL2" /inference="alignment:Splign:1.39.8" variation 199 /gene="ISL2" /replace="a" /replace="c" /db_xref="dbSNP:202060824" variation 226 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:376039978" variation 273 /gene="ISL2" /replace="g" /replace="t" /db_xref="dbSNP:151069345" variation 321 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:4636879" exon 327..589 /gene="ISL2" /inference="alignment:Splign:1.39.8" variation 405 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:368899411" variation 415 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:145221041" variation 432 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:372925154" variation 433 /gene="ISL2" /replace="g" /replace="t" /db_xref="dbSNP:147622507" variation 441 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:201140408" variation 451 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:62028361" variation 477 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:146252815" variation 560 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:375968339" variation 582 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:370935444" exon 590..873 /gene="ISL2" /inference="alignment:Splign:1.39.8" variation 592 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:376971357" variation 599 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:371415237" variation 600 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:374940510" variation 604 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:200917260" variation 612 /gene="ISL2" /replace="a" /replace="c" /db_xref="dbSNP:374903982" variation 624 /gene="ISL2" /replace="g" /replace="t" /db_xref="dbSNP:367795331" variation 651 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:200011600" variation 654 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:200114561" variation 678 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:367845589" variation 719 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:375432836" variation 828 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:372019352" variation 834 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:145440339" variation 844 /gene="ISL2" /replace="a" /replace="c" /db_xref="dbSNP:148825148" variation 858 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:376307405" variation 862 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:369945656" exon 874..1041 /gene="ISL2" /inference="alignment:Splign:1.39.8" variation 885 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:372503511" variation 890 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:202074846" variation 950 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:148002891" variation 974 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:140931798" variation 998 /gene="ISL2" /replace="a" /replace="t" /db_xref="dbSNP:145105769" variation 1011 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:138984043" variation 1026 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:115363632" variation 1028 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:376002196" exon 1042..1798 /gene="ISL2" /inference="alignment:Splign:1.39.8" variation 1080 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:150905281" variation 1114 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:138128983" variation 1116 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:114713527" variation 1190 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:368069657" variation 1266 /gene="ISL2" /replace="c" /replace="g" /db_xref="dbSNP:188500756" variation 1272 /gene="ISL2" /replace="g" /replace="t" /db_xref="dbSNP:11854453" variation 1630 /gene="ISL2" /replace="a" /replace="t" /db_xref="dbSNP:376804695" variation 1633 /gene="ISL2" /replace="a" /replace="c" /db_xref="dbSNP:367641283" variation 1659 /gene="ISL2" /replace="a" /replace="g" /db_xref="dbSNP:369682025" variation 1662 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:11634019" variation 1676 /gene="ISL2" /replace="c" /replace="t" /db_xref="dbSNP:112691062" variation 1738 /gene="ISL2" /replace="g" /replace="t" /db_xref="dbSNP:181318526" variation 1742..1743 /gene="ISL2" /replace="" /replace="cc" /db_xref="dbSNP:377674508" ORIGIN
gcaaagagccgaggccgggcgcgcgaccctcgtccttctgcccctggccgcacactttgcgcacatctctttttctgcatggtggatattatttttcattatccttttctgggtgctatgggtgatcattccaagaagaagcccgggacggccatgtgcgtgggctgcgggagtcagatccacgaccagtttatcctgcgggtgtcgcccgacctcgagtggcacgcggcctgcctcaagtgtgccgagtgcagccagtacctggacgagacgtgcacgtgcttcgtgagagacgggaagacctactgcaagcgggactacgtcaggctgttcggcatcaagtgcgccaagtgccaggtgggcttcagcagcagcgacctggtgatgagggcgcgggacagcgtgtaccacatcgagtgcttccgctgctccgtgtgcagccgccagctgctgcctggggacgagttctcgctgcgggagcacgagctgctctgccgcgccgaccacggcctcctgctcgagcgcgccgcggccggcagcccgcgcagccccggcccgcttcccggcgcccgcggcctgcatctgcccgacgctgggtcgggccggcagcccgcgttgcgcccgcacgtgcacaagcagacggagaagacgacccgcgtgcggactgtgctgaacgagaagcagctgcacactctgcggacctgctacgccgccaacccgcggcccgacgctctcatgaaggagcagctggtggagatgaccggcctgagcccgcgggtcatccgcgtctggttccagaacaagcgctgcaaggacaagaagaaatccattctcatgaagcagctgcagcagcagcagcacagcgacaagacgagccttcagggactgactgggacgcccctggtggcgggcagtcccatccgccatgagaacgccgtgcagggcagcgcagtggaggtgcagacgtaccagccgccgtggaaggcgctcagcgagtttgccctccagagcgacctggaccaacccgccttccaacagctggtctccttctccgagtccggctccctaggcaactcctccggcagcgacgtgacctccctgtcctcgcagctcccggacacccccaacagtatggtgccgagtcccgtggagacgtgagggggacccctccctgccagcccgcggacctcgcatgctccctgcatgagactcacccatgctcaggccattccagttccgaaagctctctcgccttcgtaattattctattgttatttatgagagagtaccgagagacacggtctggacagcccaaggcgccaggatgcaacctgctttcaccagactgcagacccctgctccgaggactcttagtttttcaaaaccagaatctgggacttaccagggttagctctgccctctcctctcctctctacgtggccgccgctctgtctctccacgccccacctgtgtccccatctcggccggcccggagctcgcccacgcggacccccgccctgccccagctcagcgctccctggcggcttcgcccgggctcctagcggggaaaaggaaggggataactcagaggaacagacactcaaactcccaaagcgcatgattgctgggaaacagtagaaaccagacttgccttgaaagtgtttaagttattcgacggaggacagagtatgtgagcctttgccgaacaaacaaacgtaagttattgttatttattgtgagaacagccagttcatagtgggacttgtattttgatcttaataaaaaataataacccgggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:64843 -> Molecular function: GO:0003677 [DNA binding] evidence: ISS GeneID:64843 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:64843 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA GeneID:64843 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA GeneID:64843 -> Biological process: GO:0021520 [spinal cord motor neuron cell fate specification] evidence: IEA GeneID:64843 -> Biological process: GO:0021524 [visceral motor neuron differentiation] evidence: IEA GeneID:64843 -> Biological process: GO:0031290 [retinal ganglion cell axon guidance] evidence: IEA GeneID:64843 -> Biological process: GO:0045665 [negative regulation of neuron differentiation] evidence: IEA GeneID:64843 -> Biological process: GO:0048666 [neuron development] evidence: TAS GeneID:64843 -> Biological process: GO:0048935 [peripheral nervous system neuron development] evidence: TAS GeneID:64843 -> Cellular component: GO:0005634 [nucleus] evidence: IC
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.