GGRNA Home | Help | Advanced search

2024-04-25 14:05:58, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_138960                881 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens TGFB-induced factor homeobox 2-like, X-linked
            (TGIF2LX), mRNA.
ACCESSION   NM_138960
VERSION     NM_138960.3  GI:34328940
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 881)
  AUTHORS   Lyons,P.A., Rayner,T.F., Trivedi,S., Holle,J.U., Watts,R.A.,
            Jayne,D.R., Baslund,B., Brenchley,P., Bruchfeld,A., Chaudhry,A.N.,
            Cohen Tervaert,J.W., Deloukas,P., Feighery,C., Gross,W.L.,
            Guillevin,L., Gunnarsson,I., Harper,L., Hruskova,Z., Little,M.A.,
            Martorana,D., Neumann,T., Ohlsson,S., Padmanabhan,S., Pusey,C.D.,
            Salama,A.D., Sanders,J.S., Savage,C.O., Segelmark,M.,
            Stegeman,C.A., Tesar,V., Vaglio,A., Wieczorek,S., Wilde,B.,
            Zwerina,J., Rees,A.J., Clayton,D.G. and Smith,K.G.
  TITLE     Genetically distinct subsets within ANCA-associated vasculitis
  JOURNAL   N. Engl. J. Med. 367 (3), 214-223 (2012)
   PUBMED   22808956
REFERENCE   2  (bases 1 to 881)
  AUTHORS   Ousati Ashtiani,Z., Ayati,M., Modarresi,M.H., Raoofian,R., Sabah
            Goulian,B., Greene,W.K. and Heidari,M.
  TITLE     Association of TGIFLX/Y mRNA expression with prostate cancer
  JOURNAL   Med. Oncol. 26 (1), 73-77 (2009)
   PUBMED   18663611
  REMARK    GeneRIF: most prostate tumors (73.5%) express at least one of these
            genes (TGIFLX and TGIFLY), although different patterns of mRNA
            expression were observed. These results suggest an association of
            TGIFLX/Y expression with the progression of prostate cancer.
REFERENCE   3  (bases 1 to 881)
  AUTHORS   Aarabi,M., Ousati-Ashtiani,Z., Nazarian,A., Modarressi,M.H. and
            Heidari,M.
  TITLE     Association of TGIFLX/Y mRNA expression with azoospermia in
            infertile men
  JOURNAL   Mol. Reprod. Dev. 75 (12), 1761-1766 (2008)
   PUBMED   18384077
  REMARK    GeneRIF: Association of TGIFLX/Y mRNA expression with azoospermia
            in infertile men.(
REFERENCE   4  (bases 1 to 881)
  AUTHORS   Ross,M.T., Grafham,D.V., Coffey,A.J., Scherer,S., McLay,K.,
            Muzny,D., Platzer,M., Howell,G.R., Burrows,C., Bird,C.P.,
            Frankish,A., Lovell,F.L., Howe,K.L., Ashurst,J.L., Fulton,R.S.,
            Sudbrak,R., Wen,G., Jones,M.C., Hurles,M.E., Andrews,T.D.,
            Scott,C.E., Searle,S., Ramser,J., Whittaker,A., Deadman,R.,
            Carter,N.P., Hunt,S.E., Chen,R., Cree,A., Gunaratne,P., Havlak,P.,
            Hodgson,A., Metzker,M.L., Richards,S., Scott,G., Steffen,D.,
            Sodergren,E., Wheeler,D.A., Worley,K.C., Ainscough,R.,
            Ambrose,K.D., Ansari-Lari,M.A., Aradhya,S., Ashwell,R.I.,
            Babbage,A.K., Bagguley,C.L., Ballabio,A., Banerjee,R., Barker,G.E.,
            Barlow,K.F., Barrett,I.P., Bates,K.N., Beare,D.M., Beasley,H.,
            Beasley,O., Beck,A., Bethel,G., Blechschmidt,K., Brady,N.,
            Bray-Allen,S., Bridgeman,A.M., Brown,A.J., Brown,M.J., Bonnin,D.,
            Bruford,E.A., Buhay,C., Burch,P., Burford,D., Burgess,J.,
            Burrill,W., Burton,J., Bye,J.M., Carder,C., Carrel,L., Chako,J.,
            Chapman,J.C., Chavez,D., Chen,E., Chen,G., Chen,Y., Chen,Z.,
            Chinault,C., Ciccodicola,A., Clark,S.Y., Clarke,G., Clee,C.M.,
            Clegg,S., Clerc-Blankenburg,K., Clifford,K., Cobley,V., Cole,C.G.,
            Conquer,J.S., Corby,N., Connor,R.E., David,R., Davies,J., Davis,C.,
            Davis,J., Delgado,O., Deshazo,D., Dhami,P., Ding,Y., Dinh,H.,
            Dodsworth,S., Draper,H., Dugan-Rocha,S., Dunham,A., Dunn,M.,
            Durbin,K.J., Dutta,I., Eades,T., Ellwood,M., Emery-Cohen,A.,
            Errington,H., Evans,K.L., Faulkner,L., Francis,F., Frankland,J.,
            Fraser,A.E., Galgoczy,P., Gilbert,J., Gill,R., Glockner,G.,
            Gregory,S.G., Gribble,S., Griffiths,C., Grocock,R., Gu,Y.,
            Gwilliam,R., Hamilton,C., Hart,E.A., Hawes,A., Heath,P.D.,
            Heitmann,K., Hennig,S., Hernandez,J., Hinzmann,B., Ho,S., Hoffs,M.,
            Howden,P.J., Huckle,E.J., Hume,J., Hunt,P.J., Hunt,A.R.,
            Isherwood,J., Jacob,L., Johnson,D., Jones,S., de Jong,P.J.,
            Joseph,S.S., Keenan,S., Kelly,S., Kershaw,J.K., Khan,Z.,
            Kioschis,P., Klages,S., Knights,A.J., Kosiura,A., Kovar-Smith,C.,
            Laird,G.K., Langford,C., Lawlor,S., Leversha,M., Lewis,L., Liu,W.,
            Lloyd,C., Lloyd,D.M., Loulseged,H., Loveland,J.E., Lovell,J.D.,
            Lozado,R., Lu,J., Lyne,R., Ma,J., Maheshwari,M., Matthews,L.H.,
            McDowall,J., McLaren,S., McMurray,A., Meidl,P., Meitinger,T.,
            Milne,S., Miner,G., Mistry,S.L., Morgan,M., Morris,S., Muller,I.,
            Mullikin,J.C., Nguyen,N., Nordsiek,G., Nyakatura,G., O'Dell,C.N.,
            Okwuonu,G., Palmer,S., Pandian,R., Parker,D., Parrish,J.,
            Pasternak,S., Patel,D., Pearce,A.V., Pearson,D.M., Pelan,S.E.,
            Perez,L., Porter,K.M., Ramsey,Y., Reichwald,K., Rhodes,S.,
            Ridler,K.A., Schlessinger,D., Schueler,M.G., Sehra,H.K.,
            Shaw-Smith,C., Shen,H., Sheridan,E.M., Shownkeen,R., Skuce,C.D.,
            Smith,M.L., Sotheran,E.C., Steingruber,H.E., Steward,C.A.,
            Storey,R., Swann,R.M., Swarbreck,D., Tabor,P.E., Taudien,S.,
            Taylor,T., Teague,B., Thomas,K., Thorpe,A., Timms,K., Tracey,A.,
            Trevanion,S., Tromans,A.C., d'Urso,M., Verduzco,D., Villasana,D.,
            Waldron,L., Wall,M., Wang,Q., Warren,J., Warry,G.L., Wei,X.,
            West,A., Whitehead,S.L., Whiteley,M.N., Wilkinson,J.E.,
            Willey,D.L., Williams,G., Williams,L., Williamson,A.,
            Williamson,H., Wilming,L., Woodmansey,R.L., Wray,P.W., Yen,J.,
            Zhang,J., Zhou,J., Zoghbi,H., Zorilla,S., Buck,D., Reinhardt,R.,
            Poustka,A., Rosenthal,A., Lehrach,H., Meindl,A., Minx,P.J.,
            Hillier,L.W., Willard,H.F., Wilson,R.K., Waterston,R.H., Rice,C.M.,
            Vaudin,M., Coulson,A., Nelson,D.L., Weinstock,G., Sulston,J.E.,
            Durbin,R., Hubbard,T., Gibbs,R.A., Beck,S., Rogers,J. and
            Bentley,D.R.
  TITLE     The DNA sequence of the human X chromosome
  JOURNAL   Nature 434 (7031), 325-337 (2005)
   PUBMED   15772651
REFERENCE   5  (bases 1 to 881)
  AUTHORS   Skaletsky,H., Kuroda-Kawaguchi,T., Minx,P.J., Cordum,H.S.,
            Hillier,L., Brown,L.G., Repping,S., Pyntikova,T., Ali,J., Bieri,T.,
            Chinwalla,A., Delehaunty,A., Delehaunty,K., Du,H., Fewell,G.,
            Fulton,L., Fulton,R., Graves,T., Hou,S.F., Latrielle,P.,
            Leonard,S., Mardis,E., Maupin,R., McPherson,J., Miner,T., Nash,W.,
            Nguyen,C., Ozersky,P., Pepin,K., Rock,S., Rohlfing,T., Scott,K.,
            Schultz,B., Strong,C., Tin-Wollam,A., Yang,S.P., Waterston,R.H.,
            Wilson,R.K., Rozen,S. and Page,D.C.
  TITLE     The male-specific region of the human Y chromosome is a mosaic of
            discrete sequence classes
  JOURNAL   Nature 423 (6942), 825-837 (2003)
   PUBMED   12815422
REFERENCE   6  (bases 1 to 881)
  AUTHORS   Blanco-Arias,P., Sargent,C.A. and Affara,N.A.
  TITLE     The human-specific Yp11.2/Xq21.3 homology block encodes a
            potentially functional testis-specific TGIF-like retroposon
  JOURNAL   Mamm. Genome 13 (8), 463-468 (2002)
   PUBMED   12226713
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC029920.2.
            On Aug 28, 2003 this sequence version replaced gi:32480630.
            
            Summary: This gene encodes a member of the TALE/TGIF homeobox
            family of transcription factors. Testis-specific expression
            suggests that this gene may play a role in spermatogenesis. A
            homolog of this gene lies within the male specific region of
            chromosome Y, in a block of sequence that is thought to be the
            result of a large X-to-Y transposition. [provided by RefSeq, Jul
            2008].
            
            ##Evidence-Data-START##
            Transcript exon combination :: BI830352.1, BC101144.2 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..881
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /map="Xq21.31"
     gene            1..881
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /note="TGFB-induced factor homeobox 2-like, X-linked"
                     /db_xref="GeneID:90316"
                     /db_xref="HGNC:18570"
                     /db_xref="HPRD:02328"
                     /db_xref="MIM:300411"
     STS             1..798
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /db_xref="UniSTS:486389"
     exon            1..28
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /inference="alignment:Splign:1.39.8"
     variation       1
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2444397"
     STS             16..718
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /db_xref="UniSTS:482950"
     exon            29..847
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    35..37
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /note="upstream in-frame stop codon"
     variation       45
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2496943"
     CDS             50..775
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /note="TGFB-induced factor 2-like, X-linked; TGIF-like on
                     the X; TGFB-induced factor 2-like protein, X-linked;
                     TGF-beta-induced transcription factor 2-like protein"
                     /codon_start=1
                     /product="homeobox protein TGIF2LX"
                     /protein_id="NP_620410.3"
                     /db_xref="GI:34328941"
                     /db_xref="CCDS:CCDS14459.1"
                     /db_xref="GeneID:90316"
                     /db_xref="HGNC:18570"
                     /db_xref="HPRD:02328"
                     /db_xref="MIM:300411"
                     /translation="
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
"
     misc_feature    200..370
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(200..214,218..220,278..280,296..298,335..337,
                     341..346,353..358,362..370)
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(206..208,215..217,344..346,353..358,365..367)
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       64
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2444398"
     variation       67
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372625687"
     variation       74
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11575111"
     variation       91
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148030622"
     variation       102
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369762002"
     variation       105
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377498487"
     variation       112
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370716063"
     variation       151
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200638786"
     variation       238
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375358921"
     variation       258
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368249504"
     variation       266
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370935506"
     STS             316..697
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /standard_name="sY1254"
                     /db_xref="UniSTS:259321"
     variation       321
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142605569"
     variation       329
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144880993"
     variation       336
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2496945"
     variation       394
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138727889"
     variation       426
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141862335"
     variation       451
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375524618"
     variation       454
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368668895"
     variation       469
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371679488"
     variation       490
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374776217"
     variation       491
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35845440"
     variation       493
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:66503731"
     variation       573
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367945077"
     variation       574
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150815384"
     variation       616
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34232559"
     variation       625
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371576487"
     variation       638
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2290380"
     variation       643
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:35771405"
     variation       645
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145641550"
     variation       680
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34824030"
     variation       683
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149582592"
     variation       712
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375032050"
     variation       729
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:34058937"
     variation       773
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:369523286"
     variation       782
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373148347"
     variation       799
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376626896"
     variation       806
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369936646"
     variation       813
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053792"
     variation       813
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74871541"
     variation       823
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200060527"
     polyA_site      847
                     /gene="TGIF2LX"
                     /gene_synonym="TGIFLX"
ORIGIN      
cgctgtttgtctttctcggaaacaacagtaacgataagcctcttggaatatggaggccgctgcggacggcccggctgagacccaaagcccggtggaaaaagacagcccggcgaagacccaaagcccagcccaagacacctcaatcatgtcgagaaataacgcagatacaggcagagttcttgccttaccagagcacaagaagaagcgcaagggaaacttgccagccgagtccgttaagatcctccgcgactggatgtataagcatcggtttaaggcctacccttcagaagaagagaagcaaatgctgtcagagaagaccaatttgtctttgttgcagatttctaactggtttatcaatgctcgcagacgcattctcccggatatgcttcaacagcgtagaaacgaccccatcattggccacaaaacgggcaaagatgcccatgccacccacctgcagagcaccgaggcgtctgtgccggccaagtcagggcccagtggtccagacaatgtacaaagcctgcccctgtggcccttgccaaagggccagatgtcaagagagaagcaaccagatccggagtcggcccctagccagaagctcaccggaatagcccagccgaagaaaaaggtcaaggtttctgtcacatccccgtcttctccagaacttgtgtctccagaggagcacgccgacttcagcagcttcctgctgctagtcgatgcagcagtacaaagggctgccgagctggagctagagaagaagcaagagcctaatccatgattgatgatgttccaaaaacccaagtagtcagtcccttatgtactgtggtaaacctgtttatgttcaccccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:90316 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:90316 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:90316 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:90316 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.