2024-05-08 14:05:44, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_024787 1872 bp mRNA linear PRI 19-JUL-2013 DEFINITION Homo sapiens ring finger protein 122 (RNF122), mRNA. ACCESSION NM_024787 VERSION NM_024787.3 GI:525345373 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1872) AUTHORS Wang L, Gao X, Gao P, Deng W, Yu P, Ma J, Guo J, Wang X, Cheng H, Zhang C, Yu C, Ma X, Lv B, Lu Y, Shi T and Ma D. TITLE Cell-based screening and validation of human novel genes associated with cell viability JOURNAL J Biomol Screen 11 (4), 369-376 (2006) PUBMED 16751333 REFERENCE 2 (bases 1 to 1872) AUTHORS Saurin AJ, Borden KL, Boddy MN and Freemont PS. TITLE Does this have a familiar RING? JOURNAL Trends Biochem. Sci. 21 (6), 208-214 (1996) PUBMED 8744354 REFERENCE 3 (bases 1 to 1872) AUTHORS Koyama K, Sudo K and Nakamura Y. TITLE Isolation of 115 human chromosome 8-specific expressed-sequence tags by exon amplification JOURNAL Genomics 26 (2), 245-253 (1995) PUBMED 7601449 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA610129.1, DA904646.1, BC093884.1 and AC013603.17. On Jul 19, 2013 this sequence version replaced gi:38045930. Summary: The encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi apparatus, and may be associated with cell viability. [provided by RefSeq, Jul 2013]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK022588.1, BC093884.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2 DA610129.1 1-2 3-382 DA904646.1 1-380 383-896 BC093884.1 1-514 897-1872 AC013603.17 37158-38133 c FEATURES Location/Qualifiers source 1..1872 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="8" /map="8p12" gene 1..1872 /gene="RNF122" /note="ring finger protein 122" /db_xref="GeneID:79845" /db_xref="HGNC:21147" /db_xref="HPRD:11498" misc_feature 226..228 /gene="RNF122" /note="upstream in-frame stop codon" CDS 406..873 /gene="RNF122" /codon_start=1 /product="RING finger protein 122" /protein_id="NP_079063.2" /db_xref="GI:38045931" /db_xref="CCDS:CCDS6091.1" /db_xref="GeneID:79845" /db_xref="HGNC:21147" /db_xref="HPRD:11498" /translation="
MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV
" misc_feature 523..585 /gene="RNF122" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9H9V4.2); transmembrane region" misc_feature 679..816 /gene="RNF122" /note="RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in...; Region: RING; cd00162" /db_xref="CDD:29102" misc_feature order(682..684,691..693,736..738,742..744,751..753, 760..762,793..795,802..804) /gene="RNF122" /note="cross-brace motif; other site" /db_xref="CDD:29102" polyA_signal 1842..1847 /gene="RNF122" polyA_site 1872 /gene="RNF122" ORIGIN
gtcagtttcggaaccccagccagctcacctctgcgccgctgaacccgatccgagcctccggcaaaggtttttccctcctcccccggccgagggcttctgcagcccgggcacccccgccccgcggcgccccacattcccccagcccggggcccttggcgcgtgcgctccgtgcggctgtgctccgcgggactttgtttgtttcctcctcgtccctctttgttgggctgaacaccagcctcgtcaaagccccccactccggagggagttcggcttctccagcagggcggctgcagcgcgctgccccgaccccgcctgcggcccctcacgccgctagtgctcccaccccgccctcctggcaccccgcctgcgtccgttcgcccgaggaagccaaccgcgacttcattgatgcacccattccagtggtgtaacgggtgtttctgtggcctgggactggttagcaccaacaagtcctgctcgatgccacccatcagtttccaggaccttccgctcaacatctatatggtcatcttcggcacaggcatctttgtcttcatgctcagccttatcttctgctgctattttatcagcaaactgcggaaccaggcacagagtgagcgatacggatataaggaggtggtgcttaaaggtgatgccaagaagttacaattatatgggcagacctgcgcagtctgtctggaagacttcaaggggaaggatgagttaggcgtgctcccgtgccaacacgcctttcaccgcaagtgtctggtgaaatggctggaagttcgctgtgtctgccccatgtgtaacaagcccattgctagtccctcagaggccacgcagaacattgggattctattggatgagctggtgtgagtgctgccgctacaccgagacctggagaagacctcttgcctcatggatgtctggtccctctgcacagctccaaccaacaggactgtagggtgatgacgatcactttcccagtgatgagaagggtggtctaggactgggcttctaccctcagtgcaagaccagtgccagatgtgcccccacttcctgcctcctgaagccttcttccctgctactccatgctggtggcctcacccatcaagaccactgtctcctggtactggactatctacctgccttgtccctgttctgggggaaggtgtccaccccgatcaagaacatggagaaagtcctctttcaaggctcccattaggaggatgagctgccttgacccagaagggatgagacgggctcttacctctctacaaccttccctccccttcccactccttccggagtaaggttagaagggaaggaaggaaagatcaaggaaccaagcgcctccacgggaggcgagggaggctctgtatgaaacagaagagcagggacataaaggaaaatgtcagtgtttacatgggacctatggaaacaaaggctggcgggcgccagctgactccagagtaagagagggcccttcccctgccaggacccacggtgctatccattcagtctcttcctcagttaatctcggagcttcctattccatgttgaggtttgtgggcccctctagaggagggctagttctatacttaaattgattcccaggggccttttttttttttttttttttttttttgatcaaaaggggtgtggggatgggggtgtctacggttaagcaacagatacctccttccctttgtaaatagtatttttatacttcatcctcgcctctcaggctttagatacgaaatctccagaatggaagggggtggggattttctgttcctccctggagtgggtgagggtgggagaaagttacatatttaaagaaaaataaatttaataacaagtttctctaaccta
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:79845 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA GeneID:79845 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IEA GeneID:79845 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA GeneID:79845 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.