GGRNA Home | Help | Advanced search

2024-04-27 05:02:48, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_024017               2711 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens homeobox B9 (HOXB9), mRNA.
ACCESSION   NM_024017
VERSION     NM_024017.4  GI:85415513
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2711)
  AUTHORS   Shrestha,B., Ansari,K.I., Bhan,A., Kasiri,S., Hussain,I. and
            Mandal,S.S.
  TITLE     Homeodomain-containing protein HOXB9 regulates expression of growth
            and angiogenic factors, facilitates tumor growth in vitro and is
            overexpressed in breast cancer tissue
  JOURNAL   FEBS J. 279 (19), 3715-3726 (2012)
   PUBMED   22863320
  REMARK    GeneRIF: HOXB9 is overexpressed in breast cancer tissue.
REFERENCE   2  (bases 1 to 2711)
  AUTHORS   Seki,H., Hayashida,T., Jinno,H., Takahashi,M. and Kitagawa,Y.
  TITLE     [HOXB9 as a novel prognostic factor in breast cancer]
  JOURNAL   Nippon Rinsho 70 (SUPPL 7), 166-169 (2012)
   PUBMED   23350386
  REMARK    GeneRIF: The expression of HOXB9, its relationship to clinical
            factors in breast cancer and efficacy as a prognostic factor were
            discussed.
REFERENCE   3  (bases 1 to 2711)
  AUTHORS   Kim,J.H., Kim,Y.H., Han,J.H., Lee,K.B., Sheen,S.S., Lee,J.,
            Soh,E.Y. and Park,T.J.
  TITLE     Silencing of homeobox B9 is associated with down-regulation of CD56
            and extrathyroidal extension of tumor in papillary thyroid
            carcinoma
  JOURNAL   Hum. Pathol. 43 (8), 1221-1228 (2012)
   PUBMED   22225776
  REMARK    GeneRIF: reduced expression of CD56 is associated with homeobox B9
            in papillary thyroid carcinomas. Further, silencing of homeobox B9
            is more common in older age and is linked to extrathyroidal
            extension and advanced pathologic stage of papillary thyroid
            carcinoma
REFERENCE   4  (bases 1 to 2711)
  AUTHORS   Seki,H., Hayashida,T., Jinno,H., Hirose,S., Sakata,M.,
            Takahashi,M., Maheswaran,S., Mukai,M. and Kitagawa,Y.
  TITLE     HOXB9 expression promoting tumor cell proliferation and
            angiogenesis is associated with clinical outcomes in breast cancer
            patients
  JOURNAL   Ann. Surg. Oncol. 19 (6), 1831-1840 (2012)
   PUBMED   22396001
  REMARK    GeneRIF: HOXB9 overexpression promoting tumor cell proliferation
            and angiogenesis is associated with breast cancer.
REFERENCE   5  (bases 1 to 2711)
  AUTHORS   Chiba,N., Comaills,V., Shiotani,B., Takahashi,F., Shimada,T.,
            Tajima,K., Winokur,D., Hayashida,T., Willers,H., Brachtel,E.,
            Vivanco,M.D., Haber,D.A., Zou,L. and Maheswaran,S.
  TITLE     Homeobox B9 induces epithelial-to-mesenchymal transition-associated
            radioresistance by accelerating DNA damage responses
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 109 (8), 2760-2765 (2012)
   PUBMED   21930940
  REMARK    GeneRIF: The effect of HOXB9 on the response to ionizing radiation
            requires the baseline ATM activity before irradiation and
            epithelial-to-mesenchymal transition induced by TGF-beta.
REFERENCE   6  (bases 1 to 2711)
  AUTHORS   Deguchi,Y. and Kehrl,J.H.
  TITLE     Selective expression of two homeobox genes in CD34-positive cells
            from human bone marrow
  JOURNAL   Blood 78 (2), 323-328 (1991)
   PUBMED   1712647
REFERENCE   7  (bases 1 to 2711)
  AUTHORS   Peverali,F.A., D'Esposito,M., Acampora,D., Bunone,G., Negri,M.,
            Faiella,A., Stornaiuolo,A., Pannese,M., Migliaccio,E., Simeone,A.
            et al.
  TITLE     Expression of HOX homeogenes in human neuroblastoma cell culture
            lines
  JOURNAL   Differentiation 45 (1), 61-69 (1990)
   PUBMED   1981366
REFERENCE   8  (bases 1 to 2711)
  AUTHORS   Acampora,D., D'Esposito,M., Faiella,A., Pannese,M., Migliaccio,E.,
            Morelli,F., Stornaiuolo,A., Nigro,V., Simeone,A. and Boncinelli,E.
  TITLE     The human HOX gene family
  JOURNAL   Nucleic Acids Res. 17 (24), 10385-10402 (1989)
   PUBMED   2574852
REFERENCE   9  (bases 1 to 2711)
  AUTHORS   Giampaolo,A., Acampora,D., Zappavigna,V., Pannese,M.,
            D'Esposito,M., Care,A., Faiella,A., Stornaiuolo,A., Russo,G.,
            Simeone,A. et al.
  TITLE     Differential expression of human HOX-2 genes along the
            anterior-posterior axis in embryonic central nervous system
  JOURNAL   Differentiation 40 (3), 191-197 (1989)
   PUBMED   2570724
REFERENCE   10 (bases 1 to 2711)
  AUTHORS   Boncinelli,E., Acampora,D., Pannese,M., D'Esposito,M., Somma,R.,
            Gaudino,G., Stornaiuolo,A., Cafiero,M., Faiella,A. and Simeone,A.
  TITLE     Organization of human class I homeobox genes
  JOURNAL   Genome 31 (2), 745-756 (1989)
   PUBMED   2576652
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA712230.1, DA696753.1,
            AK056123.1, BC015565.1, BX114117.1, AK056414.1 and CA426693.1.
            On Jan 19, 2006 this sequence version replaced gi:24797138.
            
            Summary: This gene is a member of the Abd-B homeobox family and
            encodes a protein with a homeobox DNA-binding domain. It is
            included in a cluster of homeobox B genes located on chromosome 17.
            The encoded nuclear protein functions as a sequence-specific
            transcription factor that is involved in cell proliferation and
            differentiation. Increased expression of this gene is associated
            with some cases of leukemia, prostate cancer and lung cancer.
            [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK056123.1, BC015565.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-100               DA712230.1         5-104
            101-221             DA696753.1         101-221
            222-925             AK056123.1         1-704
            926-1153            BC015565.1         817-1044
            1154-1668           BX114117.1         137-651
            1669-2170           AK056414.1         1492-1993
            2171-2694           BC015565.1         1755-2278
            2695-2711           CA426693.1         1-17                c
FEATURES             Location/Qualifiers
     source          1..2711
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q21.3"
     gene            1..2711
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /note="homeobox B9"
                     /db_xref="GeneID:3219"
                     /db_xref="HGNC:5120"
                     /db_xref="HPRD:00852"
                     /db_xref="MIM:142964"
     exon            1..721
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    193..195
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /note="upstream in-frame stop codon"
     CDS             205..957
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /note="homeo box B9; homeo box 2E; homeobox protein
                     Hox-2E; homeobox protein Hox-2.5"
                     /codon_start=1
                     /product="homeobox protein Hox-B9"
                     /protein_id="NP_076922.1"
                     /db_xref="GI:15029508"
                     /db_xref="CCDS:CCDS11534.1"
                     /db_xref="GeneID:3219"
                     /db_xref="HGNC:5120"
                     /db_xref="HPRD:00852"
                     /db_xref="MIM:142964"
                     /translation="
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
"
     misc_feature    205..720
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /note="Hox9 activation region; Region: Hox9_act;
                     pfam04617"
                     /db_xref="CDD:191048"
     misc_feature    760..906
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(760..774,778..780,829..831,847..849,886..888,
                     892..897,904..906)
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(766..768,775..777,895..897,904..906)
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     STS             206..381
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /standard_name="Hoxb9"
                     /db_xref="UniSTS:536656"
     STS             252..879
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /standard_name="Hoxb9"
                     /db_xref="UniSTS:536525"
     variation       273
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35068436"
     STS             662..869
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /standard_name="Hoxb9"
                     /db_xref="UniSTS:143385"
     exon            722..2701
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /inference="alignment:Splign:1.39.8"
     variation       2201
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3826540"
     variation       2263
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3826541"
     STS             2458..2584
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /standard_name="RH104186"
                     /db_xref="UniSTS:98511"
     variation       2509
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8844"
     polyA_site      2701
                     /gene="HOXB9"
                     /gene_synonym="HOX-2.5; HOX2; HOX2E"
ORIGIN      
attttgcaaggagagctgagacgggctgctccactgtactttgttggctgagaagttgagcagggggtgggggtgggagggtggggggctgggggggtcgcgtccgaaagccctcacaccggtccgggtgccacctctccctgcttgggcgccgccgcgcgagcgcttcccttccccctgcaagcgcccggataatgtctgagaatgtccatttctgggacgcttagcagctattatgtcgactcgatcataagtcacgagagtgaggacgcgcctccagccaagtttccttctggccagtacgcgagctcgcggcagccgggccacgcggagcacctggagttcccctcgtgcagcttccagcccaaagcgccggtgttcggcgcctcctgggcgccgctgagcccgcacgcgtccgggagcctgccgtccgtctaccacccttacatccagccccagggcgtcccgccggccgagagcaggtacctccgcacctggctggagccggcgccgcgcggcgaagcggccccggggcagggccaggcggcggtgaaggcggagccgctgctgggcgcgcctggggagctgctcaaacagggcacgcccgagtacagtttggaaacttcggcgggcagggaggccgtgctgtctaatcaaagacccggctacggggacaataaaatttgcgaaggaagcgaggacaaagagaggccggatcaaaccaacccctccgccaactggctgcacgctcgctcttcccggaaaaagcgctgtccctacaccaaataccagacgctggagctagagaaggagtttctgttcaatatgtacctcaccagggaccgtaggcacgaagtggccagactcctcaatctgagtgagagacaagtcaaaatctggtttcagaaccggcggatgaaaatgaagaaaatgaataaggagcagggcaaagagtaaagattaaagattacccccagtcctccctagctcttccccatctcactcttagttatgtgacgactgcaaagccagtgctgtctgggatgtattcaagtgaatggggaagggagtctctcttccaagtcctttatctgcacctagaacctccctcctttcctttgcccttacctgtctctctcttctctctaggtgtcaggagaaagttttgttgatttagaagatagaaatagttggttcctaagaatgtgatgggccacaaggaaagagagaccccagtcaagctcctagtatgccctgtaatttttctgggaagtcctagcccctcacttccagcttgcctgtttcttctctacacccacccaaaagtcacccagggacactccaactctacacagctcagcagacatccacacacagtaatggggtgagctcacaaccaccattcagtcaagtgaggtgacactccagttgcagaccatcgcacaccaaatttggcaaaacagccctcagactgtcaggcaagcccgggttctacccctaatgcaaatacccaccagggagatgtctagaggcagactcctgagtgaggtgttgcagcccaaaggctgcagcattgccataccattcccatggagttgccaactattctcaggccaagggccatggggaagatggagcaaacctagcccccaagccggtgggctagaaagtacaagaaaaggcagcacgtggttttatgaagctatcttaggtggagctactccccacctcccaccaacatatacattttgttgcaggaaatgtttaattccgcatgatgtttccctctccttccaacaaaagaaggtcaaactgtgggtcgtagagccttgacaatgttgtcctcctgttcatctgtgcaccacttgacagactgtagcttctcttgctctcgaccggccctgcattcttccgcaccctccctagctctgaaatcaactctcttcggtcgtatccaccttgcacccgcaagtcaagccgccccttgtagaaaaatccctccaccttccgttccccgctaggtcaaccccactgtagacaggaaagccaggccaggagagtccgaatgagaatttattgtgaatcgattcccaagctcccttccgggacaagtggtctgggacagggaggagcaacggccccagcgcgcaacgctctgcgcgttcctccgaatcccgtcggcttctcgacccacgcagagaagccccgggcttggcggctctagccccagcgccaaaggagacccgccccagggccgggcttggcctcctgcttcatgggcctggatgcagatctgcgtggctggtgcgtgcgcgcgcttctgggaaacagtcccgcgtgcaaaggaaaggggcaaaatggcacctaagcatcagatggaagcttactctctgcttccgttcctccccctgctcccctacttctcagtccccttcaatttgtagactcttgctcctgcttctcctgatcctgcaaggggacattccagtagaagttttttgctttgtcggtggctgtcgtgaaattgtgcttgtgtttcgtgatttctttgggggtgattgtctcgcttgttttcagttgtcgattatatgggagggttctgggtgggagtggggagggcgaggggcctagagctctaattgtttgttttggaagaaaaaaagaaaaagaacaaaaaatatatatcactctagaaaataaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:3219 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: NAS
            GeneID:3219 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:3219 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:3219 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:3219 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: NAS
            GeneID:3219 -> Biological process: GO:0007275 [multicellular organismal development] evidence: NAS
            GeneID:3219 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: IEA
            GeneID:3219 -> Biological process: GO:0030879 [mammary gland development] evidence: IEA
            GeneID:3219 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
            GeneID:3219 -> Biological process: GO:0048706 [embryonic skeletal system development] evidence: IEA
            GeneID:3219 -> Biological process: GO:0060070 [canonical Wnt receptor signaling pathway] evidence: IMP
            GeneID:3219 -> Biological process: GO:0060326 [cell chemotaxis] evidence: IDA
            GeneID:3219 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:3219 -> Cellular component: GO:0005634 [nucleus] evidence: NAS
            GeneID:3219 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
            GeneID:3219 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.