2024-04-27 05:02:48, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_024017 2711 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens homeobox B9 (HOXB9), mRNA. ACCESSION NM_024017 VERSION NM_024017.4 GI:85415513 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2711) AUTHORS Shrestha,B., Ansari,K.I., Bhan,A., Kasiri,S., Hussain,I. and Mandal,S.S. TITLE Homeodomain-containing protein HOXB9 regulates expression of growth and angiogenic factors, facilitates tumor growth in vitro and is overexpressed in breast cancer tissue JOURNAL FEBS J. 279 (19), 3715-3726 (2012) PUBMED 22863320 REMARK GeneRIF: HOXB9 is overexpressed in breast cancer tissue. REFERENCE 2 (bases 1 to 2711) AUTHORS Seki,H., Hayashida,T., Jinno,H., Takahashi,M. and Kitagawa,Y. TITLE [HOXB9 as a novel prognostic factor in breast cancer] JOURNAL Nippon Rinsho 70 (SUPPL 7), 166-169 (2012) PUBMED 23350386 REMARK GeneRIF: The expression of HOXB9, its relationship to clinical factors in breast cancer and efficacy as a prognostic factor were discussed. REFERENCE 3 (bases 1 to 2711) AUTHORS Kim,J.H., Kim,Y.H., Han,J.H., Lee,K.B., Sheen,S.S., Lee,J., Soh,E.Y. and Park,T.J. TITLE Silencing of homeobox B9 is associated with down-regulation of CD56 and extrathyroidal extension of tumor in papillary thyroid carcinoma JOURNAL Hum. Pathol. 43 (8), 1221-1228 (2012) PUBMED 22225776 REMARK GeneRIF: reduced expression of CD56 is associated with homeobox B9 in papillary thyroid carcinomas. Further, silencing of homeobox B9 is more common in older age and is linked to extrathyroidal extension and advanced pathologic stage of papillary thyroid carcinoma REFERENCE 4 (bases 1 to 2711) AUTHORS Seki,H., Hayashida,T., Jinno,H., Hirose,S., Sakata,M., Takahashi,M., Maheswaran,S., Mukai,M. and Kitagawa,Y. TITLE HOXB9 expression promoting tumor cell proliferation and angiogenesis is associated with clinical outcomes in breast cancer patients JOURNAL Ann. Surg. Oncol. 19 (6), 1831-1840 (2012) PUBMED 22396001 REMARK GeneRIF: HOXB9 overexpression promoting tumor cell proliferation and angiogenesis is associated with breast cancer. REFERENCE 5 (bases 1 to 2711) AUTHORS Chiba,N., Comaills,V., Shiotani,B., Takahashi,F., Shimada,T., Tajima,K., Winokur,D., Hayashida,T., Willers,H., Brachtel,E., Vivanco,M.D., Haber,D.A., Zou,L. and Maheswaran,S. TITLE Homeobox B9 induces epithelial-to-mesenchymal transition-associated radioresistance by accelerating DNA damage responses JOURNAL Proc. Natl. Acad. Sci. U.S.A. 109 (8), 2760-2765 (2012) PUBMED 21930940 REMARK GeneRIF: The effect of HOXB9 on the response to ionizing radiation requires the baseline ATM activity before irradiation and epithelial-to-mesenchymal transition induced by TGF-beta. REFERENCE 6 (bases 1 to 2711) AUTHORS Deguchi,Y. and Kehrl,J.H. TITLE Selective expression of two homeobox genes in CD34-positive cells from human bone marrow JOURNAL Blood 78 (2), 323-328 (1991) PUBMED 1712647 REFERENCE 7 (bases 1 to 2711) AUTHORS Peverali,F.A., D'Esposito,M., Acampora,D., Bunone,G., Negri,M., Faiella,A., Stornaiuolo,A., Pannese,M., Migliaccio,E., Simeone,A. et al. TITLE Expression of HOX homeogenes in human neuroblastoma cell culture lines JOURNAL Differentiation 45 (1), 61-69 (1990) PUBMED 1981366 REFERENCE 8 (bases 1 to 2711) AUTHORS Acampora,D., D'Esposito,M., Faiella,A., Pannese,M., Migliaccio,E., Morelli,F., Stornaiuolo,A., Nigro,V., Simeone,A. and Boncinelli,E. TITLE The human HOX gene family JOURNAL Nucleic Acids Res. 17 (24), 10385-10402 (1989) PUBMED 2574852 REFERENCE 9 (bases 1 to 2711) AUTHORS Giampaolo,A., Acampora,D., Zappavigna,V., Pannese,M., D'Esposito,M., Care,A., Faiella,A., Stornaiuolo,A., Russo,G., Simeone,A. et al. TITLE Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system JOURNAL Differentiation 40 (3), 191-197 (1989) PUBMED 2570724 REFERENCE 10 (bases 1 to 2711) AUTHORS Boncinelli,E., Acampora,D., Pannese,M., D'Esposito,M., Somma,R., Gaudino,G., Stornaiuolo,A., Cafiero,M., Faiella,A. and Simeone,A. TITLE Organization of human class I homeobox genes JOURNAL Genome 31 (2), 745-756 (1989) PUBMED 2576652 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA712230.1, DA696753.1, AK056123.1, BC015565.1, BX114117.1, AK056414.1 and CA426693.1. On Jan 19, 2006 this sequence version replaced gi:24797138. Summary: This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK056123.1, BC015565.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025085 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-100 DA712230.1 5-104 101-221 DA696753.1 101-221 222-925 AK056123.1 1-704 926-1153 BC015565.1 817-1044 1154-1668 BX114117.1 137-651 1669-2170 AK056414.1 1492-1993 2171-2694 BC015565.1 1755-2278 2695-2711 CA426693.1 1-17 c FEATURES Location/Qualifiers source 1..2711 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17q21.3" gene 1..2711 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /note="homeobox B9" /db_xref="GeneID:3219" /db_xref="HGNC:5120" /db_xref="HPRD:00852" /db_xref="MIM:142964" exon 1..721 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /inference="alignment:Splign:1.39.8" misc_feature 193..195 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /note="upstream in-frame stop codon" CDS 205..957 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /note="homeo box B9; homeo box 2E; homeobox protein Hox-2E; homeobox protein Hox-2.5" /codon_start=1 /product="homeobox protein Hox-B9" /protein_id="NP_076922.1" /db_xref="GI:15029508" /db_xref="CCDS:CCDS11534.1" /db_xref="GeneID:3219" /db_xref="HGNC:5120" /db_xref="HPRD:00852" /db_xref="MIM:142964" /translation="
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
" misc_feature 205..720 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /note="Hox9 activation region; Region: Hox9_act; pfam04617" /db_xref="CDD:191048" misc_feature 760..906 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(760..774,778..780,829..831,847..849,886..888, 892..897,904..906) /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(766..768,775..777,895..897,904..906) /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" STS 206..381 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /standard_name="Hoxb9" /db_xref="UniSTS:536656" STS 252..879 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /standard_name="Hoxb9" /db_xref="UniSTS:536525" variation 273 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /replace="a" /replace="g" /db_xref="dbSNP:35068436" STS 662..869 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /standard_name="Hoxb9" /db_xref="UniSTS:143385" exon 722..2701 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /inference="alignment:Splign:1.39.8" variation 2201 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /replace="a" /replace="g" /db_xref="dbSNP:3826540" variation 2263 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /replace="g" /replace="t" /db_xref="dbSNP:3826541" STS 2458..2584 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /standard_name="RH104186" /db_xref="UniSTS:98511" variation 2509 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" /replace="a" /replace="g" /db_xref="dbSNP:8844" polyA_site 2701 /gene="HOXB9" /gene_synonym="HOX-2.5; HOX2; HOX2E" ORIGIN
attttgcaaggagagctgagacgggctgctccactgtactttgttggctgagaagttgagcagggggtgggggtgggagggtggggggctgggggggtcgcgtccgaaagccctcacaccggtccgggtgccacctctccctgcttgggcgccgccgcgcgagcgcttcccttccccctgcaagcgcccggataatgtctgagaatgtccatttctgggacgcttagcagctattatgtcgactcgatcataagtcacgagagtgaggacgcgcctccagccaagtttccttctggccagtacgcgagctcgcggcagccgggccacgcggagcacctggagttcccctcgtgcagcttccagcccaaagcgccggtgttcggcgcctcctgggcgccgctgagcccgcacgcgtccgggagcctgccgtccgtctaccacccttacatccagccccagggcgtcccgccggccgagagcaggtacctccgcacctggctggagccggcgccgcgcggcgaagcggccccggggcagggccaggcggcggtgaaggcggagccgctgctgggcgcgcctggggagctgctcaaacagggcacgcccgagtacagtttggaaacttcggcgggcagggaggccgtgctgtctaatcaaagacccggctacggggacaataaaatttgcgaaggaagcgaggacaaagagaggccggatcaaaccaacccctccgccaactggctgcacgctcgctcttcccggaaaaagcgctgtccctacaccaaataccagacgctggagctagagaaggagtttctgttcaatatgtacctcaccagggaccgtaggcacgaagtggccagactcctcaatctgagtgagagacaagtcaaaatctggtttcagaaccggcggatgaaaatgaagaaaatgaataaggagcagggcaaagagtaaagattaaagattacccccagtcctccctagctcttccccatctcactcttagttatgtgacgactgcaaagccagtgctgtctgggatgtattcaagtgaatggggaagggagtctctcttccaagtcctttatctgcacctagaacctccctcctttcctttgcccttacctgtctctctcttctctctaggtgtcaggagaaagttttgttgatttagaagatagaaatagttggttcctaagaatgtgatgggccacaaggaaagagagaccccagtcaagctcctagtatgccctgtaatttttctgggaagtcctagcccctcacttccagcttgcctgtttcttctctacacccacccaaaagtcacccagggacactccaactctacacagctcagcagacatccacacacagtaatggggtgagctcacaaccaccattcagtcaagtgaggtgacactccagttgcagaccatcgcacaccaaatttggcaaaacagccctcagactgtcaggcaagcccgggttctacccctaatgcaaatacccaccagggagatgtctagaggcagactcctgagtgaggtgttgcagcccaaaggctgcagcattgccataccattcccatggagttgccaactattctcaggccaagggccatggggaagatggagcaaacctagcccccaagccggtgggctagaaagtacaagaaaaggcagcacgtggttttatgaagctatcttaggtggagctactccccacctcccaccaacatatacattttgttgcaggaaatgtttaattccgcatgatgtttccctctccttccaacaaaagaaggtcaaactgtgggtcgtagagccttgacaatgttgtcctcctgttcatctgtgcaccacttgacagactgtagcttctcttgctctcgaccggccctgcattcttccgcaccctccctagctctgaaatcaactctcttcggtcgtatccaccttgcacccgcaagtcaagccgccccttgtagaaaaatccctccaccttccgttccccgctaggtcaaccccactgtagacaggaaagccaggccaggagagtccgaatgagaatttattgtgaatcgattcccaagctcccttccgggacaagtggtctgggacagggaggagcaacggccccagcgcgcaacgctctgcgcgttcctccgaatcccgtcggcttctcgacccacgcagagaagccccgggcttggcggctctagccccagcgccaaaggagacccgccccagggccgggcttggcctcctgcttcatgggcctggatgcagatctgcgtggctggtgcgtgcgcgcgcttctgggaaacagtcccgcgtgcaaaggaaaggggcaaaatggcacctaagcatcagatggaagcttactctctgcttccgttcctccccctgctcccctacttctcagtccccttcaatttgtagactcttgctcctgcttctcctgatcctgcaaggggacattccagtagaagttttttgctttgtcggtggctgtcgtgaaattgtgcttgtgtttcgtgatttctttgggggtgattgtctcgcttgttttcagttgtcgattatatgggagggttctgggtgggagtggggagggcgaggggcctagagctctaattgtttgttttggaagaaaaaaagaaaaagaacaaaaaatatatatcactctagaaaataaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:3219 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: NAS GeneID:3219 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:3219 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA GeneID:3219 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:3219 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: NAS GeneID:3219 -> Biological process: GO:0007275 [multicellular organismal development] evidence: NAS GeneID:3219 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: IEA GeneID:3219 -> Biological process: GO:0030879 [mammary gland development] evidence: IEA GeneID:3219 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA GeneID:3219 -> Biological process: GO:0048706 [embryonic skeletal system development] evidence: IEA GeneID:3219 -> Biological process: GO:0060070 [canonical Wnt receptor signaling pathway] evidence: IMP GeneID:3219 -> Biological process: GO:0060326 [cell chemotaxis] evidence: IDA GeneID:3219 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:3219 -> Cellular component: GO:0005634 [nucleus] evidence: NAS GeneID:3219 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA GeneID:3219 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.